DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or59c

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:260 Identity:51/260 - (19%)
Similarity:91/260 - (35%) Gaps:95/260 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KIYYFQWYGDELDEVVEALETFHPWAQKGPGAVDYRTAKRWYFTLAFFLASSW-----LVFLCIF 164
            |.::.:.....||:.|.:|:           |.||      |:.:||||  .|     .:...|:
  Fly     3 KFFFKRLQTAPLDQEVSSLD-----------ASDY------YYRIAFFL--GWTPPKGALLRWIY 48

  Fly   165 ILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLSVSIY 229
            .|..:|: :|:....|||..:..:..|              |..:....|||          |:.
  Fly    49 SLWTLTT-MWLGIVYLPLGLSLTYVKH--------------FDRFTPTEFLT----------SLQ 88

  Fly   230 VEITFAIEVLCLELRHLHQRCHGYEQL----RLETNRLVQFHQKIVHILDHTNKVFHGTLIMQMG 290
            |:|.....|:        :.|..|.|:    |:  |.|:....|.. :.....::||        
  Fly    89 VDINCIGNVI--------KSCVTYSQMWRFRRM--NELISSLDKRC-VTTTQRRIFH-------- 134

  Fly   291 VNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEAYDPI 355
                                |:||:..::::|   .||.:..|..|....|:...:|.::.|:|:
  Fly   135 --------------------KMVARVNLIVIL---FLSTYLGFCFLTLFTSVFAGKAPWQLYNPL 176

  Fly   356  355
              Fly   177  176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 51/260 (20%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 28/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.