DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or59b

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:223 Identity:42/223 - (18%)
Similarity:74/223 - (33%) Gaps:59/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RGNVHRFVKFYIDGWKHFRDPTMESSYSAVY-YWR--------------------EQMK------ 41
            :||::.:...::.||    .|..|.....|| :|.                    ::.|      
  Fly    20 QGNIYLYRAMWLIGW----IPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIISYVQEFKNFTPGE 80

  Fly    42 -------AMFLYTTSKERQMPYRSSWHTLVIIQATVCFLTMCYGVTESLGDKVQMGRD---IAFI 96
                   .:.:|..|.:..:.|...|.    ::.|...|       :||..::....|   |..:
  Fly    81 FLTSLQVCINVYGASVKSTITYLFLWR----LRKTEILL-------DSLDKRLANDSDRERIHNM 134

  Fly    97 IGFFYIAFKIYYFQWYGDELDEVVE-ALETFHPWAQKGPGAVDYR--TAKRWYFTLAFFLASSWL 158
            :.....||.||.|.:.|......:. ||....||:...| .:|:|  ....|...:..::..|:.
  Fly   135 VARCNYAFLIYSFIYCGYAGSTFLSYALSGRPPWSVYNP-FIDWRDGMGSLWIQAIFEYITMSFA 198

  Fly   159 VF---LCIFILLLITSPLWVHQQILPLH 183
            |.   |.....|:.|.....|.::|..|
  Fly   199 VLQDQLSDTYPLMFTIMFRAHMEVLKDH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 24/106 (23%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 32/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.