DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or59a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:327 Identity:67/327 - (20%)
Similarity:119/327 - (36%) Gaps:79/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DIRGNVHRFVKFYIDGWKHFRDPTMESSYSAVYYWREQMKAMFLYTTSKERQMPYRSSWHTLVII 66
            ::|.:...|.|.:...|:          |..|.::|.:                   :|..|.:.
  Fly     3 EVRVDSLEFFKSHWTAWR----------YLGVAHFRVE-------------------NWKNLYVF 38

  Fly    67 QATV--CFLTMCYGVTESLGDKVQMGR----DIAFIIGFFYIAFKIYYFQWYGDELDEVVEALET 125
            .:.|  ..:|:||.|  .||..:...|    ||..:..|............|...:.:|:|....
  Fly    39 YSIVSNLLVTLCYPV--HLGISLFRNRTITEDILNLTTFATCTACSVKCLLYAYNIKDVLEMERL 101

  Fly   126 FHPWAQK--GPGAVDYRTAKRWYFTLAFFLASSWLVFLCIFI---LLLITSPLWVHQQILPLHAA 185
            .....::  ||   :.|:.   |..:...|.:...||:.|::   |....|.|:..::.|...|.
  Fly   102 LRLLDERVVGP---EQRSI---YGQVRVQLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYPAW 160

  Fly   186 FPFQWHEKSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLSVSI---YVEITFAIEVLCLELRHLH 247
            |||.|              |..|.|  |::.....|.|:|..:   ||...|...||||...|:.
  Fly   161 FPFDW--------------LHSTRN--YYIANAYQIVGISFQLLQNYVSDCFPAVVLCLISSHIK 209

  Fly   248 QRCHGYEQLRLETNR--------LVQFHQKIVHILDHTNKVFHGTLIMQMGVNFFLVSLSVLEAM 304
            ...:.:|::.|:..|        .:..|:   |||:...:: ...:.:.|.:.|.:.:|:|...:
  Fly   210 MLYNRFEEVGLDPARDAEKDLEACITDHK---HILELFRRI-EAFISLPMLIQFTVTALNVCIGL 270

  Fly   305 EA 306
            .|
  Fly   271 AA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 51/240 (21%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 50/235 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.