DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or45b

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:360 Identity:73/360 - (20%)
Similarity:140/360 - (38%) Gaps:97/360 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FYIAFKIYYFQWYGDELDEVVEALETFHPWAQKGPGAVDYRTAKRWY-----------FTL---- 149
            |...||:.:..|...|:.::::.:.......:|...: ..:.|:|.|           |||    
  Fly    83 FTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDS-RRKVAQRSYYLMVTRCGMLVFTLGSIT 146

  Fly   150 --AFFLASSWLVFLCIFILLLITSPLWV--HQQI---LPLHAAFPFQWHEKSIHPISHAFIYLFQ 207
              ||.|.|.|              .:||  ||:.   :|....|....|.....|:    .||:.
  Fly   147 TGAFVLRSLW--------------EMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPV----FYLYS 193

  Fly   208 TWNVMYFLTWLVCIEGLSVSIYVEITFAIEVLCLELRHLHQRCHGYEQLR---LETNRLVQFHQK 269
            ||:....:......:|......:.:.|.::.|..:::      ...:.:|   |..:::.  .|:
  Fly   194 TWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYDIQ------DALKPIRDPSLRESKIC--CQR 250

  Fly   270 IVHILDHTNKV------FHGTLIMQMGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGH-- 326
            :..|:|..|::      |.|.:.....|:|...||             |:|...:.:||..|:  
  Fly   251 LADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASL-------------VIATSVIDILLYSGYNI 302

  Fly   327 -------------LSMWSYFGDLLSQKSLTISEAAYEA----YDPIKGSKDVYRDLCLIIRRGQE 374
                         :.::.|.|..:|.:||::.||||.:    :|     ::..|.:.|||.|.|.
  Fly   303 IRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWD-----RETRRRVFLIILRAQR 362

  Fly   375 PLIMRASPFPSFNFINYSAILNQCYGILTFLLKTL 409
            |:.:|. ||.:.:...::::: :..|.:..|.||:
  Fly   363 PITVRV-PFFAPSLPVFTSVI-KFTGSIVALAKTI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 69/348 (20%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 69/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.