DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or43b

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:381 Identity:62/381 - (16%)
Similarity:126/381 - (33%) Gaps:130/381 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LVIIQATVCFLTMCYGVTESLGDKVQMGRDIAFIIGFFYI---AFKIYYFQWYGDELDE-VVEAL 123
            |::....:|..|.|                  |.:.||.:   ..::.....:.||||: .|:..
  Fly    79 LLLQSLQLCLNTWC------------------FALKFFTLIVYTHRLELANKHFDELDKYCVKPA 125

  Fly   124 ETFHPWAQKGPGAVDYRTAKRWYFTLAFFLASSWLVFLCIFILLLITSPL--WVHQQILPLHAAF 186
            |                  ||....:...:...:|.|:.:::|...::.|  .:|.:: |.:..:
  Fly   126 E------------------KRKVRDMVATITRLYLTFVVVYVLYATSTLLDGLLHHRV-PYNTYY 171

  Fly   187 PF-QWHEKSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLSVSIYVEITFAIEVLCLELRHLHQRC 250
            || .|..........:|:..|.....:|..|   ..:...| ||| ......:|.|:.|.::   
  Fly   172 PFINWRVDRTQMYIQSFLEYFTVGYAIYVAT---ATDSYPV-IYV-AALRTHILLLKDRIIY--- 228

  Fly   251 HGYEQLRLETNR--------------LVQFHQKIVHILDHTNKVFHGTLIMQ-------MGVNFF 294
                 |...:|.              .::.|:.:::..|....:..||:..|       :|:  .
  Fly   229 -----LGDPSNEGSSDPSYMFKSLVDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGI--I 286

  Fly   295 LVSLSVLEAMEARKDPKVVAQFAVLMLL-------------------ALGHLSMWSYFGDLLSQK 340
            :::: ||.|.::.:...|:...|||:..                   ||.|.:.|          
  Fly   287 MINM-VLFADQSTRFGIVIYVMAVLLQTFPLCFYCNAIVDDCKELAHALFHSAWW---------- 340

  Fly   341 SLTISEAAYEAYDPIKGSKDVYRDLCLIIRRGQEPLIMRASPFPSFNFINYSAILN 396
               :.:..|:            |.:...:::.|:|:     .|.:.|..|.:...|
  Fly   341 ---VQDKRYQ------------RTVIQFLQKLQQPM-----TFTAMNIFNINLATN 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 58/357 (16%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 57/347 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.