DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or42b

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:315 Identity:59/315 - (18%)
Similarity:106/315 - (33%) Gaps:116/315 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 LHAAFPF-QWHEKSIHPISHAFIYLFQTWNVMYFL---TWL------------------------ 218
            |:.|..| .|    :.|......|::.||.:|.|:   |:|                        
  Fly    24 LYRAMKFIGW----LPPKQGVLRYVYLTWTLMTFVWCTTYLPLGFLGSYMTQIKSFSPGEFLTSL 84

  Fly   219 -VCIEGLSVSIYVEITFAIEVLCLE----LRHLHQRCHGYEQLRLETNRLVQFHQKIVHILDHTN 278
             |||.....|:.|.||:::....::    |..|..||...|:           .:||..::..:|
  Fly    85 QVCINAYGSSVKVAITYSMLWRLIKAKNILDQLDLRCTAMEE-----------REKIHLVVARSN 138

  Fly   279 KVF------------------------------------HGTLIMQMG--VNFFLVSLSVLEAME 305
            ..|                                    .|||.:.:.  :.:.::|.:||:...
  Fly   139 HAFLIFTFVYCGYAGSTYLSSVLSGRPPWQLYNPFIDWHDGTLKLWVASTLEYMVMSGAVLQDQL 203

  Fly   306 ARKDPKVVAQFAVLMLLALGHLSMW-SYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLCLII 369
            :...|      .:..|:...||.|. .....|.|.::|:.:|:..|....:...|.:.| .|.||
  Fly   204 SDSYP------LIYTLILRAHLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILR-YCAII 261

  Fly   370 RRGQEPLIMRASPFPSFNFIN----------------YSAILNQCYGILTFLLKT 408
            :    |:| :.:.|..|..|.                ::.|.:..: ::|.||:|
  Fly   262 K----PVI-QGTIFTQFLLIGLVLGFTLINVFFFSDIWTGIASFMF-VITILLQT 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 55/304 (18%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 47/259 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.