DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or33b

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:389 Identity:79/389 - (20%)
Similarity:150/389 - (38%) Gaps:105/389 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDIRGNVHRFVKFYIDGWKHFRDPTMESSYSAVYYWREQMKAMFLYTTSKERQMPYRSSWHTLVI 65
            ||::..|.|....|...|.::....:||::             ||               :.|:.
  Fly     1 MDLKPRVIRSEDIYRTYWLYWHLLGLESNF-------------FL---------------NRLLD 37

  Fly    66 IQATVCFLTMCYGV--------TESLGDKVQMGRDIAFIIGFFYIAFKIYYFQWYGDELDEVVEA 122
            :..|: |:|:.|.:        ..||||   :.:.:......|:.:||...|::   :|.|:.|.
  Fly    38 LVITI-FVTIWYPIHLILGLFMERSLGD---VCKGLPITAACFFASFKFICFRF---KLSEIKEI 95

  Fly   123 LETFHPWAQKGPGAVDYRTAKR---WYFTL-----AFFLASSWLVFLCIFILLLITSPLW--VHQ 177
            ...|.        .:|.|...|   .:|..     |.|:..|::|...:..:..|.|.|:  .|:
  Fly    96 EILFK--------ELDQRALSREECEFFNQNTRREANFIWKSFIVAYGLSNISAIASVLFGGGHK 152

  Fly   178 QILPLHAAFPFQWHEKSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLSVSI--------YVEITF 234
            .:.|  |.||                |..|...::::|:....|.|:|::|        |..:||
  Fly   153 LLYP--AWFP----------------YDVQATELIFWLSVTYQIAGVSLAILQNLANDSYPPMTF 199

  Fly   235 A-----IEVLCLELRHLHQRCHGYEQ-LRLETNRLVQF---HQ---KIVHILDHTNKVFHGTLIM 287
            .     :.:|.:.|..:.|   |.|: :.|...:|::.   |:   |||.:|..|..:......:
  Fly   200 CVVAGHVRLLAMRLSRIGQ---GPEETIYLTGKQLIESIEDHRKLMKIVELLRSTMNISQLGQFI 261

  Fly   288 QMGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEA 351
            ..|||   :|::::..:....:...:..:.|..|..:..|....|:|.|:|.:...::.|.|.:
  Fly   262 SSGVN---ISITLVNILFFADNNFAITYYGVYFLSMVLELFPCCYYGTLISVEMNQLTYAIYSS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 60/295 (20%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 64/300 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.