DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or33a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:417 Identity:81/417 - (19%)
Similarity:165/417 - (39%) Gaps:89/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ESSYSAVY-YWREQMKAMFLYTTSKERQMPYRSSWHTLVIIQATV-CFLTMCYGVTESLG----D 85
            |:.|...: |||         ....|...|:|.      ::..|: .|:|:.:.|...||    .
  Fly    10 ENLYKTYWLYWR---------LLGVEGDYPFRR------LVDFTITSFITILFPVHLILGMYKKP 59

  Fly    86 KVQMGRDIAFIIGFFYIAFKIYYFQWYGDELDEVVEALETFHPWAQKGPGAVDYRT---AKRWYF 147
            ::|:.|.:.|.....:.::|.:.|:|...|:..:...|:.           :|.|.   .:|.||
  Fly    60 QIQVFRSLHFTSECLFCSYKFFCFRWKLKEIKTIEGLLQD-----------LDSRVESEEERNYF 113

  Fly   148 T-----LAFFLASSWLVFLCIFILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPISHAFIYLFQ 207
            .     :|..|:.|:||.....|:....:.|:...:.|.....||                |.||
  Fly   114 NQNPSRVARMLSKSYLVAAISAIITATVAGLFSTGRNLMYLGWFP----------------YDFQ 162

  Fly   208 TWNVMYFLTW--------LVCIEGLSVSIYVEITFA-----IEVLCLELRHLHQRCHGYEQLRL- 258
            ....:|::::        |:.:|.|:...|..|||.     :.:|.:.|..:     |:: ::| 
  Fly   163 ATAAIYWISFSYQAIGSSLLILENLANDSYPPITFCVVSGHVRLLIMRLSRI-----GHD-VKLS 221

  Fly   259 ---ETNRL---VQFHQKIVHILDHTNKVFHGTLIMQM---GVNFFLVSLSVLEAMEARKDPKVVA 314
               .|.:|   :|.|:|::.|:.......|.:.:.|.   |:|   :|::::..:...::...:.
  Fly   222 SSENTRKLIEGIQDHRKLMKIIRLLRSTLHLSQLGQFLSSGIN---ISITLINILFFAENNFAML 283

  Fly   315 QFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRDLCLIIRRGQEPLIMR 379
            .:||.....|..|....|:|.|::.:...:..|.:.: :.:|..|...|.|.::::....|:.::
  Fly   284 YYAVFFAAMLIELFPSCYYGILMTMEFDKLPYAIFSS-NWLKMDKRYNRSLIILMQLTLVPVNIK 347

  Fly   380 ASPFPSFNFINYSAILNQCYGILTFLL 406
            |......:...:.|.:...|...|..|
  Fly   348 AGGIVGIDMSAFFATVRMAYSFYTLAL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 64/342 (19%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 64/342 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.