DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or23a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:267 Identity:55/267 - (20%)
Similarity:95/267 - (35%) Gaps:88/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 GAVDYRTAKRWYFTLAFFLASSWLVFLCIFILLLITSPLWVHQQILPLHAAFPFQWHEKSIHPIS 199
            ||:|....:.|          ||.:.||  ||:.:.:|:.       |...:.|:      .|:.
  Fly    23 GALDLSEGRYW----------SWSMLLC--ILVYLPTPML-------LRGVYSFE------DPVE 62

  Fly   200 HAF---IYLFQTWNVMYFLTWLVCIEGLSVSIYVEITFAIEVLCLELRHLHQRCHGYEQLR---- 257
            :.|   :.:....|:|.|..::           .::|..:||..| :..|..|..|..|..    
  Fly    63 NNFSLSLTVTSLSNLMKFCMYV-----------AQLTKMVEVQSL-IGQLDARVSGESQSERHRN 115

  Fly   258 -----LETNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVNFFLVSLSVLEAMEARKDP-----KV 312
                 |..::|.|....:|.|:.....||...|.:.|.:.|                |     .:
  Fly   116 MTEHLLRMSKLFQITYAVVFIIAAVPFVFETELSLPMPMWF----------------PFDWKNSM 164

  Fly   313 VAQFAVLMLLALGHL--SMWSYFGD--------LLSQKS----LTISEAAYEAYDPIKGSKDVYR 363
            ||....|:...:|::  .|..:..|        |:|::.    |.|||..| .|..::.::   :
  Fly   165 VAYIGALVFQEIGYVFQIMQCFAADSFPPLVLYLISEQCQLLILRISEIGY-GYKTLEENE---Q 225

  Fly   364 DLCLIIR 370
            ||...||
  Fly   226 DLVNCIR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 55/267 (21%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 42/206 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.