DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or22b

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:437 Identity:91/437 - (20%)
Similarity:154/437 - (35%) Gaps:121/437 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 MESSYSAVYYWREQMKAMFLYTTSKERQMPYRSSWHTLVIIQATVCFLTMCYGV---------TE 81
            ::|..:.||..|......:....:|...:.|: .|.|.|.:   :.|:.:...|         |.
  Fly    18 VKSRDAFVYLDRVMWSFGWTVPENKRWDLHYK-LWSTFVTL---LIFILLPISVSVEYIQRFKTF 78

  Fly    82 SLGD---KVQMGRDIAFIIGFFYIAFKIYY-FQWYG---------DELDE--VVEALETF-HPWA 130
            |.|:   .:|:|      :..:..:||.|. ...|.         ||||:  |.:...|. |...
  Fly    79 SAGEFLSSIQIG------VNMYGSSFKSYLTMMGYKKRQEAKMSLDELDKRCVCDEERTIVHRHV 137

  Fly   131 QKGPGAVDYRTAKRWYFTLAFFLASSWLVFLCIFILLLITSPLWVHQQILPLHA---AFPFQWHE 192
            ..|.....:     ::.....||.|::|.|:                 :..:||   .||:...|
  Fly   138 ALGNFCYIF-----YHIAYTSFLISNFLSFI-----------------MKRIHAWRMYFPYVDPE 180

  Fly   193 KSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLSVSIYVEITFA---IEVLCLELRHLHQRCHGYE 254
            |..:..|.|.:.| :.|.|...|...||       ..:.:..|   |.:|...||:|..     |
  Fly   181 KQFYISSIAEVIL-RGWAVFMDLCTDVC-------PLISMVIARCHITLLKQRLRNLRS-----E 232

  Fly   255 QLRLETNRL------VQFHQKIVHILDHTNKVFHGTLIMQMGVNFFLVSLSVLEAMEARKDPKVV 313
            ..|.|...|      |:.|:.|:..:|....||.||:.:|..:...::.||::..|...     .
  Fly   233 PGRTEDEYLKELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFS-----T 292

  Fly   314 AQFAVLMLLALGHLSMWSY---------------FGDLLSQKSLTISEAAYEAYDPIKGSKDVYR 363
            ....|.::|.:..:||.::               ..|.|.|...|.::..|::            
  Fly   293 LSTGVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKS------------ 345

  Fly   364 DLCLIIRRGQEPLIMRA-SPFPSFNFINYSAILNQCYGILTFLLKTL 409
            .|...:...|:|:|:.| ..||    |:....||...  |.|.:.|:
  Fly   346 TLVYFLHNLQQPIILTAGGVFP----ISMQTNLNMVK--LAFTVVTI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 74/352 (21%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 76/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.