DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and AgaP_AGAP003055

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_562811.3 Gene:AgaP_AGAP003055 / 3290734 VectorBaseID:AGAP003055 Length:177 Species:Anopheles gambiae


Alignment Length:176 Identity:44/176 - (25%)
Similarity:82/176 - (46%) Gaps:19/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LTWLVCIEGLSVSIYVEITFAIEVLCLELRHLHQRCHGYEQLRL--ETNRLVQFHQKIVHILDHT 277
            :.:||.|:||.|...:.....|::|.:.::.|.   .|.||..|  |..|::|.||:|...:...
Mosquito     4 ILFLVGIDGLLVLSILAAVHQIKLLKITIQELD---IGAEQAELHRELVRIIQIHQRIQQFIHQL 65

  Fly   278 NKVFHGTLIMQMGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSL 342
            .:.::..|:    |:|.||.|.:...:....| :|:......::..:..||:..:.|:||..:|.
Mosquito    66 EQTYYIDLL----VDFGLVCLILCMGLNVIAD-EVINAIWFFLIAVVFQLSLLCFSGNLLLIESD 125

  Fly   343 TISEAAYEAYD----PIKGSKDVYRDLCLIIRRGQEPLIMRASPFP 384
            ::|...| :.|    |:...|    .|.::|...|:|.::|....|
Mosquito   126 SLSSCVY-SIDWHAMPVPEQK----LLMVMIAHAQKPQVLRGIFMP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 44/176 (25%)
AgaP_AGAP003055XP_562811.3 7tm_6 <1..175 CDD:251636 44/176 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21137
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.