DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or10a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:457 Identity:92/457 - (20%)
Similarity:163/457 - (35%) Gaps:122/457 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WKHF--RDPTMESSYSAVYYW---REQMKAMFLYTTSKERQMPYRSSWHTLVI-------IQATV 70
            |..|  ||..::     ||::   |..:..|..:........|:||..|..::       :.|.:
  Fly     4 WLRFLKRDQQLD-----VYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILAIGVATELHAGM 63

  Fly    71 CFL----------TMCYGVTESLGDKVQMGRDIAFIIGFFYIAFKIYYFQWYGDELDEVVEALE- 124
            |||          |:|...|.:          :..:..|..:.|:        .:|..:...|. 
  Fly    64 CFLDRQQITLALETLCPAGTSA----------VTLLKMFLMLRFR--------QDLSIMWNRLRG 110

  Fly   125 -TFHP-WAQKGPGAVDYR-----TAKR---WYFTLAFFLASSW-----LVFLCIFILLLITSPLW 174
             .|.| |.:  |...|.|     .|.|   |..:..||..:::     |:.:.:::.......:|
  Fly   111 LLFDPNWER--PEQRDIRLKHSAMAARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVW 173

  Fly   175 VHQQILPLHAAFPFQWHEKSIHPISHAF--------IYLFQTWNVMYFLTWLVCIEGLSVSIYVE 231
                ..|.:...|.........|:::.|        |::|...:..||            .....
  Fly   174 ----FTPFNMTMPKVLLNYPFFPLTYIFIAYTGYVTIFMFGGCDGFYF------------EFCAH 222

  Fly   232 ITFAIEVLCLELRHLHQRCHGY-EQLRLETNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVNFFL 295
            ::...|||..|:..:.:   .| :.|.|...:|....||:..::...|.:...|...:.......
  Fly   223 LSALFEVLQAEIESMFR---PYTDHLELSPVQLYILEQKMRSVIIRHNAIIDLTRFFRDRYTIIT 284

  Fly   296 VSLSVLEAMEARKDPKVVAQFAVLMLLALGH------------------LSMWSYFGDLLSQKSL 342
            ::..|..||        |..|:::.||.||:                  |.::.|.|.|:::.|.
  Fly   285 LAHFVSAAM--------VIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESST 341

  Fly   343 TISEAAYEAYDPIKGSKDVYRDLC-LIIRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFLL 406
            .:..|.:..  |.:..|...|.|. |:|.|.|.|:.| |.||.|.:...::||| |..|.:..|:
  Fly   342 GLCRAMFSC--PWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAIL-QTSGSIIALV 402

  Fly   407 KT 408
            |:
  Fly   403 KS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 70/355 (20%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 73/376 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.