DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or2a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:446 Identity:82/446 - (18%)
Similarity:158/446 - (35%) Gaps:96/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DIRGNVHRFVKFYIDGWK---HFRDPTMESSYSAVYYWREQMKAMFLYTTSKERQMPYRSSWHTL 63
            |.:.|.|..|.::...|:   ..|.|.:.|....||.....:....|:..|              
  Fly     6 DFKLNTHSAVYYHWRVWELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLS-------------- 56

  Fly    64 VIIQATVCFLTMCYGVTESLGDKVQMGRDIAFIIGF--FYIAFKIYYFQWYGDELDEVVEALETF 126
              :.|.:.|.|...|:.|:|...:   .||...:.|  .|:..|         :|.|:...|...
  Fly    57 --LLARLLFTTNMAGLCENLTITI---TDIVANLKFANVYMVRK---------QLHEIRSLLRLM 107

  Fly   127 HPWAQKGPGAVDYRTAKRWYFTLA---FFLASSWLVF----LCIFILLL----ITSPLWVHQQIL 180
            ...|:. .|..:..:|.|....:|   |...:|..||    .|:.:::.    :..|.|      
  Fly   108 DARARL-VGDPEEISALRKEVNIAQGTFRTFASIFVFGTTLSCVRVVVRPDRELLYPAW------ 165

  Fly   181 PLHAAFPFQWHEKSIHPI-SHAFIYLFQTWNVMYFLTWLVCIEGLSVSIYVEITFAI---EVLCL 241
                 |...|    :|.. ::..|.::|.:.::     :..|:..:...|......:   .:..|
  Fly   166 -----FGVDW----MHSTRNYVLINIYQLFGLI-----VQAIQNCASDSYPPAFLCLLTGHMRAL 216

  Fly   242 ELRHLHQRC--------HGYEQLRLETNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVNF----- 293
            |||.....|        ..||..|.|.      :|:::..:....:|.....|:|..::.     
  Fly   217 ELRVRRIGCRTEKSNKGQTYEAWREEV------YQELIECIRDLARVHRLREIIQRVLSVPCMAQ 275

  Fly   294 FLVSLSV-----LEAMEARKDPKVVAQFAVLMLLALGHLSMW--SYFGDLLSQKSLTISEAAYEA 351
            |:.|.:|     :..:....|....|....::..:...|.::  .||||.:..:|..:.:|.|:.
  Fly   276 FVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDC 340

  Fly   352 YDPIKGSKDVYRDLCLIIRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFLLK 407
             :.|:......|:|...:.|.|.|.::.|..:.:.:...:..::...|.:.|.||:
  Fly   341 -NWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLLR 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 60/348 (17%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 63/360 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.