DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and Or69a

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:430 Identity:77/430 - (17%)
Similarity:144/430 - (33%) Gaps:153/430 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NVHRFVKFYIDG----WK------HFRDPTME----------SSYSAVYY---WREQMKAMFLYT 47
            :|...:.|.|.|    ||      ||.:...|          .:|...:|   :...::..|::.
  Fly    79 SVASMLGFTIVGTLNLWKMLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQEKYTRHIRNTFIFH 143

  Fly    48 TSKERQMPYRSSWHTLVIIQATVCFLTMCYGVTESLGDKVQMGRDIAFIIGFFYIAFKIYYFQWY 112
            ||   .:.|.:|...|::|:             |...:..|:|             ::|....||
  Fly   144 TS---AVVYYNSLPILLMIR-------------EHFSNSQQLG-------------YRIQSNTWY 179

  Fly   113 GDELDEVVEALETFHPWAQKG--PGAVDYRTAKRWYFTLAFFLASSWLVFLCIFILLLITSPLWV 175
                           ||..:|  ||               ||.|.:..:|.|             
  Fly   180 ---------------PWQVQGSIPG---------------FFAAVACQIFSC------------- 201

  Fly   176 HQQILPLHAAFPFQWHEKSIHPISHAFIYLFQT-WNVMYFLTWLVCIEGLSVSIYVEITFAIEVL 239
                                           || ..|..|:.:|:...|:.:.|:.: ..|.::.
  Fly   202 -------------------------------QTNMCVNMFIQFLINFFGIQLEIHFD-GLARQLE 234

  Fly   240 CLELRHLHQRCHGYEQLRLETNRLVQFHQKIVHILDHTNKVFHGTLIMQMGVN-----FFLVSLS 299
            .::.|:.|.:    :||:.    |:.:|.|::::.|..|:.|:.|.::.:.|:     |...|::
  Fly   235 TIDARNPHAK----DQLKY----LIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMT 291

  Fly   300 VLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISEAAYEAYDPIKGSKDVYRD 364
            :.:...:.|      ....|:|....:.||......|:......:..|.|..:  .:|.. |||.
  Fly   292 MFDFGTSLK------HLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNW--YEGDL-VYRR 347

  Fly   365 LCLII-RRGQEPLIMRASPFPSFNFINYSAILNQCYGILT 403
            :.||: .|..:|.:.:.......:...|.|.|...|.:.|
  Fly   348 MLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFT 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 56/320 (18%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 75/424 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.