DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65c and GPROR55

DIOPT Version :9

Sequence 1:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster
Sequence 2:XP_310072.3 Gene:GPROR55 / 1271301 VectorBaseID:AGAP009397 Length:372 Species:Anopheles gambiae


Alignment Length:208 Identity:44/208 - (21%)
Similarity:82/208 - (39%) Gaps:34/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 YFLTWLVCIEGLSV---SIYVEITFAIEVLCLELRHLHQRCHGYEQLRLETNR-----LVQFHQK 269
            |...::.|.:.:.|   :.|..:.|.:..|.|:          |:...:.::|     :|..||:
Mosquito   180 YVCAYVGCAKIMIVFNFTSYCTVYFRLVALQLQ----------YQTRTVPSDRDSIRTIVAMHQQ 234

  Fly   270 IVHILDHTNKVFHGTLIMQMGVNFFLVSLSVL----EAMEARKDPKVVAQFAVLMLLALGHLSMW 330
            .:...|....:....::||:.:...:.|..||    ..|.... ..|:..|.|:.....|    :
Mosquito   235 ALCCADLLETIVSPIMLMQIVLCVLMSSSMVLYFTFPTMSGHM-INVLLLFLVVSTETFG----Y 294

  Fly   331 SYFGDLLSQKSLTISEAAYEA---YDPIKGSKDVYRDLCLIIRRGQEPLIMRASPFPSFNFINYS 392
            .|.|..||.:|..|:.|.|..   ..|    :::.:.|.||:.|.|:|:.:.|..|...|...::
Mosquito   295 CYLGTQLSMESARIAYAVYNGKWEQQP----REIAKHLQLILLRAQKPIGITAGKFCFINMEQFA 355

  Fly   393 AILNQCYGILTFL 405
            .:|...|.:...|
Mosquito   356 KLLKTTYSVFILL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 42/200 (21%)
GPROR55XP_310072.3 7tm_6 <178..362 CDD:251636 42/200 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21137
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.