DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or19a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:305 Identity:54/305 - (17%)
Similarity:105/305 - (34%) Gaps:104/305 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 FFLATSWSFFLCILLLLLI----------TSPMWVHQQNLPFHAAFPFQWHEKS--------LHP 193
            |...|.:....|.::|.:|          ..|.|:           |:.|.:.:        ||.
  Fly   128 FIFRTIFRGLACTVVLGIIYISASSEPTLMYPTWI-----------PWNWRDSTSAYLATAMLHT 181

  Fly   194 ---ISHAIIYL-FQSYFAVYCLTWLLCIEGLSICIYAEITFGIEVLCLELRQIHRHNYG--LQEL 252
               :::|.:.| ..||...|.                 |...:....|.|| :.:..||  |..:
  Fly   182 TALMANATLVLNLSSYPGTYL-----------------ILVSVHTKALALR-VSKLGYGAPLPAV 228

  Fly   253 RMETNRLVKLHQ-----KIVEILDRTNDV-----FHGTLIMQMGVNFSLVSLSVLEAVEARKDPK 307
            ||:...:..:|.     ::.:.|:|:..:     |..|...|..:.:.|:..:|          .
  Fly   229 RMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNV----------G 283

  Fly   308 VVAQFAVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPTKGSKD----VY---------- 358
            ::....:|.||.:            |:.::|.:   .|.|..|.|..:.    ||          
  Fly   284 IMRFMNMLFLLVI------------LTTETLLL---CYTAELPCKEGESLLTAVYSCNWLSQSVN 333

  Fly   359 --RDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFL 401
              |.|.:::.|.|.|:|:.:......::..::.::...|.:||.|
  Fly   334 FRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 50/297 (17%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 50/297 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.