DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or98b

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:364 Identity:66/364 - (18%)
Similarity:130/364 - (35%) Gaps:120/364 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ERLLPYRSKWHTLVYIQMVIFF--ASMSFG---------LTESM-------------GDHVQMGR 87
            |:.:.:|..|.::..|..|..|  .:::||         ||:|:             |..:.:.:
  Fly    24 EQDVGHRYPWRSICCILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLVDLLALCKIGLFLWLYK 88

  Fly    88 DLAFILGAFFIIFKTYYFCWYGDELDQVISDLDALHPWAQKGPNPVEYQTGKRWYFVMAF----F 148
            |..|::|.|:.:.:|        |....::::             :..:..:|..|:.|.    |
  Fly    89 DFKFLIGQFYCVLQT--------ETHTAVAEM-------------IVTRESRRDQFISAMYAYCF 132

  Fly   149 LATSWSFFLCILLLLLI----TSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVY 209
            :....|..|...|.:||    |..:   |...||.:.:|  |....|   |:.||    |||   
  Fly   133 ITAGLSACLMSPLSMLISYQRTGEL---QPKFPFPSVYP--WDNMKL---SNYII----SYF--- 182

  Fly   210 CLTWLLCIEGLSICIYAEITFGIEVLCLE------------LRQIHRHNYGLQELRMETNRLVKL 262
               |.:|         |.:...:..:|::            |.||.||    :.:..|.....:.
  Fly   183 ---WNVC---------AALGVALPTVCVDTLFCSLSHNLCALFQIARH----KMMHFEGRNTKET 231

  Fly   263 HQKIVEILDR----------TNDVFHGTLIMQMGVNFSL------VSLSVLEAVEARKDPKVVAQ 311
            |:.:..:...          .|:.|...:...:..:..|      :|.::|:       |.::. 
  Fly   232 HENLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLSANILQ-------PALLF- 288

  Fly   312 FAVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDP 350
            :|......:|.:|::.:||..:..:.....:|.||:..|
  Fly   289 YAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 54/304 (18%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 58/329 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.