DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or85d

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:420 Identity:89/420 - (21%)
Similarity:180/420 - (42%) Gaps:48/420 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IQRFLKFYKVGWKTYRDPLMEASHSSIYYWREQMKAMALFTTTEERLLPYRSKWHTLVYIQMVIF 67
            :..|||:..|.:.:.  .:|...|.....|:|    :.|..|...:::    ..:|::..:::..
  Fly    21 LHSFLKYANVFYLSI--GMMAYDHKYSQKWKE----VLLHWTFIAQMV----NLNTVLISELIYV 75

  Fly    68 FASMSFGLTESMGDHVQMGRDLAFILGAFFII--FKTYYFCWYGDELDQVISDLDALHP--WAQK 128
            |.::..|     .:.::...:|:||  .|.|:  ||.:........|.||:|.|:.|||  .||:
  Fly    76 FLAIGKG-----SNFLEATMNLSFI--GFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQ 133

  Fly   129 GPNPV-----EYQTGKRWYFVMAFFLATSWSFFLCILLLLLITSPMWV----HQQNLPFHAAFPF 184
            .|..:     .|....::||.|...|..:::.:..:..|:   ...|:    .::.||::...|:
  Fly   134 EPYNIGHHLSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLV---CDFWLGMRQFERMLPYYCWVPW 195

  Fly   185 QWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAEITFGIEVLCLELRQIHRHNYGL 249
            .|..    ..|:..:|:.|:.....||:..|..:.| :|  |.:|..:.........|..|..|:
  Fly   196 DWST----GYSYYFMYISQNIGGQACLSGQLAADML-MC--ALVTLVVMHFIRLSAHIESHVAGI 253

  Fly   250 QELRMETNRL---VKLHQKIVEILDRTNDVFHGTLIMQ-MGVNFSLVSLSVLEAVEARKDPKVVA 310
            ...:.:...|   |..||.::.:....|::|..:|:.. :..:|.:..:.....:.::.|..|: 
  Fly   254 GSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVGFQMTIGSKIDNLVM- 317

  Fly   311 QFAVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPTKGSKDVYRDLCVIIRRGQDPLIMR 375
             ..:.:..|:..:.|.:....:|...|.||.:|.|. :|..:......:.|.:||:|.|.|..::
  Fly   318 -LVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYN-HDWFRADLRYRKMLILIIKRAQQPSRLK 380

  Fly   376 ASPFPSFNLINYSAILNQCYGILTFLLKTL 405
            |:.|.:.:|:..|.:|...|.... ||:|:
  Fly   381 ATMFLNISLVTVSDLLQLSYKFFA-LLRTM 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 72/328 (22%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 72/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.