DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or85a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:363 Identity:65/363 - (17%)
Similarity:123/363 - (33%) Gaps:124/363 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 REQMKAMAL-FTTTEERLLPYRSK--WHTLVYIQMVIFFASMSFGLTESMGDHVQMGRDLAFILG 94
            ::.|.||.: .|..||::..:|:.  .:.:|.|...|:|..:|..||.::               
  Fly   112 QKMMDAMDIRCTKMEEKVQVHRAAALCNRVVVIYHCIYFGYLSMALTGAL--------------- 161

  Fly    95 AFFIIFKTYYFCWYGDELDQVISDLDALHPWAQKGPNPVEYQTGKRWYFVMAFFLATSWSFFLCI 159
               :|.|| .||.|...:                  ||.::           |:|||        
  Fly   162 ---VIGKT-PFCLYNPLV------------------NPDDH-----------FYLAT-------- 185

  Fly   160 LLLLLITSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICI 224
                                          ::..::.|.|.|......||.:.:::.:.     |
  Fly   186 ------------------------------AIESVTMAGIILANLILDVYPIIYVVVLR-----I 215

  Fly   225 YAE-ITFGIEVLCLELRQIHRHNYGLQELRMETNRLVKLHQKIVEILDRTNDVFHGTLIMQM--- 285
            :.| ::..|:.|..::.:....:|.      |....||.|:.|||..:....:...|:.:|:   
  Fly   216 HMELLSERIKTLRTDVEKGDDQHYA------ELVECVKDHKLIVEYGNTLRPMISATMFIQLLSV 274

  Fly   286 GVNFSLVSLS------VLEAVEARKDPKVVAQFAVLMLLALGHLSMWSYCGDQLSQKSLQISEAA 344
            |:...|.::|      |:|.|.:          .|..:..|.....:.|..:|||.....::...
  Fly   275 GLLLGLAAVSMQFYNTVMERVVS----------GVYTIAILSQTFPFCYVCEQLSSDCESLTNTL 329

  Fly   345 YEAYDPTKGSKDVYR-DLCVIIRRGQDPLIMRASP-FP 380
            :  :....|::..|| .:...|...|..::..|.. ||
  Fly   330 F--HSKWIGAERRYRTTMLYFIHNVQQSILFTAGGIFP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 51/310 (16%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 65/363 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465234
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.