DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or83c

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:406 Identity:71/406 - (17%)
Similarity:133/406 - (32%) Gaps:125/406 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WREQMKA----------MALFTTTEERLLPYRSKWHTLVYIQMVIFFASMSFGLTESMGD--HVQ 84
            ||..:||          :..|.|.   ||.::.....::|.|.:       :...|:.||  |..
  Fly    65 WRVGLKASLMTGGLFHGLGKFLTC---LLKHQDMRRLVLYSQSI-------YDEYETRGDSYHRT 119

  Fly    85 MGRDLAFILGAFFIIFKTYYFCWYGDELDQVISDLDALHPWAQKGPNPVEYQTGKRWYFVMAFFL 149
            :..::..:||...||...|.|.:       .:.:|..|......|......|     |.:....|
  Fly   120 LNSNIDRLLGIMKIIRNGYVFAF-------CLMELLPLAMLMYDGTRVTAMQ-----YLIPGLPL 172

  Fly   150 ATSWSFFLCILLLLLITSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWL 214
            ..::.:   ::..::.|..|.|  |.:.|::.                      ..|....||.:
  Fly   173 ENNYCY---VVTYMIQTVTMLV--QGVGFYSG----------------------DLFVFLGLTQI 210

  Fly   215 LCIEGLSICIYAEITFGIEVLCLELRQIHRHNYGL------QELRMETNRLVKLHQKIVEILDRT 273
            |....:......|:...:|... |.|.:.|....:      |.|.::   :::.||...:.....
  Fly   211 LTFADMLQVKVKELNDALEQKA-EYRALVRVGASIDGAENRQRLLLD---VIRWHQLFTDYCRAI 271

  Fly   274 NDVFH---GTLIMQMGVNFSL---VSLSVLEAVEARKDPKVVAQFAVLMLLALGHLSMWSYC--G 330
            |.:::   .|.::.|.:...|   ::||......|             :...:...||..||  |
  Fly   272 NALYYELIATQVLSMALAMMLSFCINLSSFHMPSA-------------IFFVVSAYSMSIYCILG 323

  Fly   331 DQLSQKSLQISEAAYEAYDPTKGSKDVYRDLCVII-------RRGQDPLIMRASPFPSFNLINYS 388
                    .|.|.||:         .||..:|.:.       :|.....::|.|.:| .|:    
  Fly   324 --------TILEFAYD---------QVYESICNVTWYELSGEQRKLFGFLLRESQYP-HNI---- 366

  Fly   389 AILNQCYGILTFLLKT 404
                |..|:::..::|
  Fly   367 ----QILGVMSLSVRT 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 55/332 (17%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 69/402 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.