DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or67d

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:398 Identity:75/398 - (18%)
Similarity:149/398 - (37%) Gaps:88/398 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YRSKWHTLVYIQMVIFFASMSFGLTESMGDHVQMGRDLAFILGAFFII----------FKTYYFC 106
            :|..|.|...:..:.||.:.: |.|..:|  |.:..||..||.|..::          ..|....
  Fly    36 FRMWWLTYAVMAAIAFFFACT-GYTIYVG--VVINGDLTIILQALAMVGSAVQGLTKLLVTANNA 97

  Fly   107 WYGDELDQVISDLDALHPWAQKGPNPVEYQ--TGKR----WYFVMAFFLATSWSFFLCILLLLLI 165
            .:..|:.....|:     :.:.|....||.  ..||    |..::.|.|.      ..|||.|:|
  Fly    98 SHMREVQNTYEDI-----YREYGSKGDEYAKCLEKRIRITWTLLIGFMLV------YIILLGLVI 151

  Fly   166 TSPMW----VHQQNLPFHAAFPFQWHEKS----LHPISHAIIYLFQSYFAVYCLTWLLCIEGLSI 222
            |.|::    :||:.|......||..|...    :...:|.|:..|.. |..|         |..:
  Fly   152 TFPIFYLLILHQKVLVMQFLIPFLDHTTDGGHLILTAAHVILITFGG-FGNY---------GGDM 206

  Fly   223 CIYAEIT---FGIEVLCLELRQIHRHNYGLQELRMETNRLVKL----------HQKIVEILDRTN 274
            .::..:|   ...::.|::|.:.:       ||.|:.|...|:          ||....:|..|.
  Fly   207 YLFLFVTHVPLIKDIFCVKLTEFN-------ELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTK 264

  Fly   275 DVFHGTLIMQMGVNFSLVSLSVLEAVEARKDPKVVAQFAVLMLLALGHLSMWSYCG-----DQLS 334
            .::...|.:|:... .:..|..:..:..:..|      |..:.|....::::::||     :..:
  Fly   265 KIYSIVLFVQLSTT-CVGLLCTISCIFMKAWP------AAPLYLLYAAITLYTFCGLGTLVENSN 322

  Fly   335 QKSLQISEAAYEAYD-PTKGSKDVYRDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGIL 398
            :..|.:.......|: |.|..|.:    .:::.:.|:.:::.|:.....::   :..|....||.
  Fly   323 EDFLSVIYTNCLWYELPVKEEKLI----IMMLAKAQNEVVLTAADMAPLSM---NTALQLTKGIY 380

  Fly   399 TFLLKTLD 406
            :|.:..::
  Fly   381 SFSMMLMN 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 64/354 (18%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 64/352 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.