DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or67c

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:308 Identity:66/308 - (21%)
Similarity:134/308 - (43%) Gaps:28/308 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LDQVISDLDALHPWAQKGPNPVEY------QTGKRWYFVMAFF---LATSWSFFLCILLLLLITS 167
            |..::.||:.:||  :.....:||      :|.||...:..|.   ..|::||:..|...:....
  Fly   106 LIMLLDDLENMHP--KTLAKQMEYKLPDFEKTMKRVINIFTFLCLAYTTTFSFYPAIKASVKFNF 168

  Fly   168 PMW-VHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAEITFG 231
            ..: ...:|..|...|||   :.:.:.:.:.|:|...::.|.......||.:.|.:.:..:|...
  Fly   169 LGYDTFDRNFGFLIWFPF---DATRNNLIYWIMYWDIAHGAYLAGIAFLCADLLLVVVITQICMH 230

  Fly   232 IEVLCLELRQIHRHNYGLQELRME-TNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNFSLVSLS 295
            ...:.:.|.. |..|....:..:| ...:::.|.|.:::.:..||::..:|::    ||.:.|:.
  Fly   231 FNYISMRLED-HPCNSNEDKENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLL----NFLMASMQ 290

  Fly   296 V----LEAVEARKDPKVVAQFAVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPTKGSKD 356
            :    .:..|:..:  |:..:.:.::.::..:.|..|.||.|...||::.:|||. ....:.||.
  Fly   291 ICFIAFQVTESTVE--VIIIYCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYN-QKWFQCSKS 352

  Fly   357 VYRDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFLLKT 404
            ....|.::|.|.|.|..:|...||..:|:.|..:::..|.....|..|
  Fly   353 YCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSYQFFALLRTT 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 63/297 (21%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 63/297 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.