DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or67b

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:364 Identity:64/364 - (17%)
Similarity:120/364 - (32%) Gaps:120/364 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DIQRFLKFYKVG--WKTYRDPLMEASHSSIYYWREQMKAMALFTTTEERLLPYRSKWHTLVYIQM 64
            :::|..|..|:|  |..|          |.|       |:.:.....:|    .||:..|..|.:
  Fly     8 ELERIDKLPKLGLLWVEY----------SAY-------ALGVNIAPRKR----SSKYCRLTRILV 51

  Fly    65 VIFFASMSFGLTESMGDHVQMGRDLAFILGAFFIIFKTY------------------YFCWYGDE 111
            :|...|:.:.|             :|||:..:.|.|:||                  :|....:.
  Fly    52 LIVNLSIIYSL-------------VAFIMENYMISFETYVEAVLLTFQLSVGVVKMFHFQNKVES 103

  Fly   112 LDQVISDLDALHPWAQKGPNPVEYQTGKRWYFVMAFFLATSWS--------FF--LCILLLLLIT 166
            ..|::...:........|...::....|.....::..|..:|.        ||  :|:.:|....
  Fly   104 CSQLVFSTETGEVLKSLGLFQLDLPRKKELLSSVSLILLNNWMIIDRQVMFFFKIVCMPVLYYCV 168

  Fly   167 SPMWVH------------QQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEG 219
            .|.:.:            :..|.:.|..|:              :.|....|..|.:.:.|...|
  Fly   169 RPYFQYIFDCYIKDKDTCEMTLTYPAIVPY--------------LQLGNYEFPSYVIRFFLLQSG 219

  Fly   220 LSICIYAEITFGIEVLCLELRQIHRHNYGL------------QELRMETNRLVKLHQKIVEILDR 272
            ...|.:|  .||...|.:.|.   |:..||            .::.:..::.||..|..|.:..|
  Fly   220 PLWCFFA--VFGFNSLFVVLT---RYESGLIKVLRFLVQNSTSDILVPKDQRVKYLQCCVRLFAR 279

  Fly   273 TN-------DVFHGTLIMQMGVNFSLVSL------SVLE 298
            .:       ::|...:::|..|:..|:.:      :|||
  Fly   280 ISSHHNQIENLFKYIILVQCSVSSILICMLLYKISTVLE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 47/281 (17%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.