DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or67a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:277 Identity:66/277 - (23%)
Similarity:116/277 - (41%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 YQTGKRWYFVMAFFLATSWSFFLCILLLLLITSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAII 199
            |..|....|::.:|.......|:..:..:|:..|  ..:|.:||:...|:::.:..|        
  Fly   140 YTKGFGGLFMIMYFAHALIPLFIYFIQRVLLHYP--DAKQIMPFYQLEPWEFRDSWL-------- 194

  Fly   200 YLFQSYF----AVYCLTWLLC--IEGLSICIYA---EITFGIEVLCLELRQ--IHRHN--YGLQE 251
             .:.|||    |.|..|   |  |.| .:.|:|   ::....|.|...||:  |..||  .|.:|
  Fly   195 -FYPSYFHQSSAGYTAT---CGSIAG-DLMIFAVVLQVIMHYERLAKVLREFKIQAHNAPNGAKE 254

  Fly   252 LRMETNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNFSLVSLSVLEAVEARKDPKVVAQFAVLM 316
            ...:...||..|..|:.:.|..|:||...|::....:..||.|..::...| ..|:...:..:.:
  Fly   255 DIRKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIASALLVCLVGVQLTIA-LSPEYFCKQMLFL 318

  Fly   317 LLALGHLSMWSYCGDQLSQKSLQISE-AAYEAYD-PTKGSKDVYRDLCVII-RRGQDPLIMRASP 378
            :..|  |.::..|  ..||:.:..|| ..:.||| ...||...::.:.:.| .|.|.|:.::|:.
  Fly   319 ISVL--LEVYLLC--SFSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATV 379

  Fly   379 FPSFNLINYSAILNQCY 395
            ....::...|..|...|
  Fly   380 VLDLSMPTMSIFLGMSY 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 65/275 (24%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 65/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.