DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or59b

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:444 Identity:81/444 - (18%)
Similarity:149/444 - (33%) Gaps:128/444 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLMEASHS---SIYYWREQMKAMAL--FTTTEERLLPYRSKWHTLVYIQMVIFFASMSFGLTESM 79
            ||.|...|   :||.:|    ||.|  :...:|.:|.|...:.|.|.....:|:..:.|.::   
  Fly    11 PLTEKVQSRQGNIYLYR----AMWLIGWIPPKEGVLRYVYLFWTCVPFAFGVFYLPVGFIIS--- 68

  Fly    80 GDHVQMGRDLAFILGAFFIIFK--------------TYYFCW-------YGDELDQVI---SDLD 120
              :||..::  |..|.|....:              ||.|.|       ..|.||:.:   ||.:
  Fly    69 --YVQEFKN--FTPGEFLTSLQVCINVYGASVKSTITYLFLWRLRKTEILLDSLDKRLANDSDRE 129

  Fly   121 ALHPWAQKGPNPVEYQTGKRWYFVMAFFLATSWSFFLC------ILLLLLITSPMW-VHQQNLPF 178
            .:|....:    ..|          ||.:   :||..|      .|...|...|.| |:...:.:
  Fly   130 RIHNMVAR----CNY----------AFLI---YSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDW 177

  Fly   179 HAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAEITFGIEVLCLELRQIH 243
            .......|.:.....|:.:...|.......|.|.:.:....                .:|:.:.|
  Fly   178 RDGMGSLWIQAIFEYITMSFAVLQDQLSDTYPLMFTIMFRA----------------HMEVLKDH 226

  Fly   244 RHNYGLQELRMETNR--------LVKL---HQKIVEILDRTNDVFHGTLIMQMGVNFSLVSLSVL 297
                 ::.|||:..|        ||..   |:.|::..|....:...|:.:|..:..|::.|:::
  Fly   227 -----VRSLRMDPERSEADNYQDLVNCVLDHKTILKCCDMIRPMISRTIFVQFALIGSVLGLTLV 286

  Fly   298 EAVEARKDPKVVAQ--FAVLMLLALGHLSMWSYC-------------GDQLSQKSLQISEAAYEA 347
            .........|.||.  |.:.:|     |..:.:|             .:::.|.:...:|..|:|
  Fly   287 NVFFFSNFWKGVASLLFVITIL-----LQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKA 346

  Fly   348 YDPTKGSKDVYRDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFL 401
                        .|.:.:...|.|:|..|......::.:...:....:.|:|.:
  Fly   347 ------------TLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 62/368 (17%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 59/359 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465231
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.