DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or59a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:436 Identity:77/436 - (17%)
Similarity:152/436 - (34%) Gaps:107/436 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKFYKVGWKTYRDPLMEASHSSIYYWREQMKAMALFTTTEERLLP------------YRSKWHTL 59
            |:|:|..|..:|  .:..:|..:..|    |.:.:|.:....||.            :|::..|.
  Fly     9 LEFFKSHWTAWR--YLGVAHFRVENW----KNLYVFYSIVSNLLVTLCYPVHLGISLFRNRTITE 67

  Fly    60 VYIQMVIFFASMSFGL-----TESMGDHVQMGRDLAFILGAFFIIFKTYYFCWYGDELDQVISDL 119
            ..:.:..|....:..:     ..::.|.::|.|.|..:                 ||  :|:   
  Fly    68 DILNLTTFATCTACSVKCLLYAYNIKDVLEMERLLRLL-----------------DE--RVV--- 110

  Fly   120 DALHPWAQKGP------NPVEYQTGKRWYFVMAFFLATSWSFFLCILLLLLITSPMWVHQQNLPF 178
                     ||      ..|..|.....|..:..::.       |.|...|  |.::..::.|.:
  Fly   111 ---------GPEQRSIYGQVRVQLRNVLYVFIGIYMP-------CALFAEL--SFLFKEERGLMY 157

  Fly   179 HAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICI---YAEITFGIEVLCL--- 237
            .|.|||.|    ||  |....|:..:|..|          |:|..:   |....|...||||   
  Fly   158 PAWFPFDW----LH--STRNYYIANAYQIV----------GISFQLLQNYVSDCFPAVVLCLISS 206

  Fly   238 ELRQIHR--HNYGLQELR---METNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNFSLVSLSV- 296
            .::.::.  ...||...|   .:....:..|:.|:|:..|    ....:.:.|.:.|::.:|:| 
  Fly   207 HIKMLYNRFEEVGLDPARDAEKDLEACITDHKHILELFRR----IEAFISLPMLIQFTVTALNVC 267

  Fly   297 --LEAVEARKDPKVVAQFAVLMLLALGHLSMWSYC--GDQLSQKSLQISEAAYEAYDPTKGSKDV 357
              |.|:.......:...:.:...||: .|.::..|  |........::..||:.....|: ::..
  Fly   268 IGLAALVFFVSEPMARMYFIFYSLAM-PLQIFPSCFFGTDNEYWFGRLHYAAFSCNWHTQ-NRSF 330

  Fly   358 YRDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFLLK 403
            .|.:.:.:.:........|......:|..:.:.|...|.:.|.:::
  Fly   331 KRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSLFTIIIR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 60/333 (18%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 63/365 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.