DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or56a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:457 Identity:90/457 - (19%)
Similarity:159/457 - (34%) Gaps:137/457 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TYRDPLMEASHSSIYYW------REQMK-AMALFTTTEERLLPYRSKWHTLVYIQMVIF--FASM 71
            |:.||:. .:|...:.|      ::|.: .::|...|    :...|.|.:...:...:|  :.::
  Fly    13 TFEDPIF-GTHLRYFQWYGYVASKDQNRPLLSLIRCT----ILTASIWLSCALMLARVFRGYENL 72

  Fly    72 SFGLTESMGDHVQMGRDLAFILGAFFII----FKTYYFCWYGDELDQVISDLDALHPWAQKGPNP 132
            :.|.| |....||           :|.:    |..|.      :.|:|||.|...|...|.    
  Fly    73 NDGAT-SYATAVQ-----------YFAVSIAMFNAYV------QRDKVISLLRVAHSDIQN---- 115

  Fly   133 VEYQTGKRWYFVMAFFLATSWSFFLCILLLLLITSPM--WVHQQNLPFHAAF-PFQWHEKSL--- 191
            :.::...|   .|...:||. ::...|.||:.|.|.:  .:...:..:.:.| |     ||:   
  Fly   116 LMHEADNR---EMELLVATQ-AYTRTITLLIWIPSVIAGLMAYSDCIYRSLFLP-----KSVFNV 171

  Fly   192 --------HPISHAIIYLFQSY-FAVYCLTWLLCIEG----LSICIYAEITFGIEVLCLELRQIH 243
                    ||     |.|||.: |...|..:::...|    |.:.|.|...:...:.|| ::.: 
  Fly   172 PAVRRGEEHP-----ILLFQLFPFGELCDNFVVGYLGPWYALGLGITAIPLWHTFITCL-MKYV- 229

  Fly   244 RHNYGLQEL--RMETNRLVKLHQKIV-------EILDRTNDVFHGTLIMQMGVNFSLVSLSVLEA 299
              |..||.|  |:|...:.:|:.|:|       |:......:|...:..|:.:...:..|..|..
  Fly   230 --NLKLQILNKRVEEMDITRLNSKLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLIC 292

  Fly   300 VEARKD-------------------PKVVAQFAVLMLLALGHLSMWSY---------CGDQLSQK 336
            |....|                   |..:..|.:.:.|.:....:|.|         |.|:||  
  Fly   293 VPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYLFVMAGILWIYHWHATLIVECHDELS-- 355

  Fly   337 SLQISEAAYEAYDPTKGSKDVYRDLCVIIRRGQDPLIMRA---------------SPFPSFNLIN 386
                  .||.:.........:.:.|..::...|.|:.|||               ..:..|||:.
  Fly   356 ------LAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRALLVDLNLRTFIDIGRGAYSYFNLLR 414

  Fly   387 YS 388
            .|
  Fly   415 SS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 76/381 (20%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 58/303 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.