DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or42b

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:325 Identity:56/325 - (17%)
Similarity:117/325 - (36%) Gaps:66/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 TYYFCWYGDELDQVISDLDALHPWAQKGPNPVEYQTGKRWYFVMAFFLATSWSFFLC------IL 160
            ||...|...:...::..|| |...|.:....:.....:..:   ||.:.|   |..|      .|
  Fly   100 TYSMLWRLIKAKNILDQLD-LRCTAMEEREKIHLVVARSNH---AFLIFT---FVYCGYAGSTYL 157

  Fly   161 LLLLITSPMWVHQQNLPFHAAFPFQWHEKSLH----------PISHAII--YLFQSYFAVYCLTW 213
            ..:|...|.|  |...||     ..||:.:|.          .:|.|::  .|..||..:|.|. 
  Fly   158 SSVLSGRPPW--QLYNPF-----IDWHDGTLKLWVASTLEYMVMSGAVLQDQLSDSYPLIYTLI- 214

  Fly   214 LLCIEGLSICIYAEITFGIEVLCLELRQIHRHNYGLQELRM--ETNRLVKLHQKIVEILDRTNDV 276
                          :...:::|...:|:: |.:..|.|...  |..:.|..|:.|:........|
  Fly   215 --------------LRAHLDMLRERIRRL-RSDENLSEAESYEELVKCVMDHKLILRYCAIIKPV 264

  Fly   277 FHGTLIMQ-----MGVNFSLVSLSVLEAVEARKDPKVVAQFAVLMLLALGHLSMWSYCGDQLSQK 336
            ..||:..|     :.:.|:|:::.....:...     :|.|..::.:.| ....:.|..:.:.:.
  Fly   265 IQGTIFTQFLLIGLVLGFTLINVFFFSDIWTG-----IASFMFVITILL-QTFPFCYTCNLIMED 323

  Fly   337 SLQISEAAYEA--YDPTKGSKDVYRDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILT 399
            ...::.|.:::  .|.::..|..   |...::..|.|::..|......::.:..::....:.::|
  Fly   324 CESLTHAIFQSNWVDASRRYKTT---LLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVIT 385

  Fly   400  399
              Fly   386  385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 55/319 (17%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 55/319 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.