DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or35a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:177 Identity:41/177 - (23%)
Similarity:64/177 - (36%) Gaps:77/177 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ERLLPYRSKWHTLVYIQMVIFFASMSFGLTESMGDHV---QMGRDL-------AFILGAF----- 96
            |::|..|.:.|....::::|         |:::..:|   |.|:.|       .||:.||     
  Fly   230 EKILVARDRPHMAKQLKVLI---------TKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLL 285

  Fly    97 -FIIFKTY--------YFCWYGDE------LDQVISDL----DALHP------W---AQKGPNPV 133
             .:.||.|        |..|:|.:      |.|:.|||    |:|..      |   .|...||.
  Fly   286 CALSFKAYTNPMANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPS 350

  Fly   134 E-------------------YQTGKRWYFVMAF-----FLATSWSFF 156
            |                   |.||.: ||.::.     .|..|:|:|
  Fly   351 ENLRLLKLINLAIEMNSKPFYVTGLK-YFRVSLQAGLKILQASFSYF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 35/141 (25%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 38/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.