DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or33c

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:441 Identity:82/441 - (18%)
Similarity:149/441 - (33%) Gaps:111/441 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LKFYKVGWKTYRDPLMEASHSSIYYWREQMKAMALFTTTEERLL----PYRSKWHTLVYIQMVIF 67
            |.||:..|...|  |:..:     ::::..:.:.|:......|:    |.....|.|:......|
  Fly     7 LSFYRPFWICMR--LLVPT-----FFKDSSRPVQLYVVLLHILVTLWFPLHLLLHLLLLPSTAEF 64

  Fly    68 FASMSFGLT--ESMGDHVQMGRDLAFILGAFFIIFKTYYFCWYGDELDQVISDLDALHPWAQKGP 130
            |.:::..||  .....||.....|..|:                 |::.:|..||..        
  Fly    65 FKNLTMSLTCVACSLKHVAHLYHLPQIV-----------------EIESLIEQLDTF-------- 104

  Fly   131 NPVEYQTGKRWY----------FVMAFFLATSWSFFLCIL-LLLLITSPMWVHQQNLPFHAAFPF 184
              :..:...|:|          |....:::....:.|.:. :.:.:.|..|    .|.:.|.|||
  Fly   105 --IASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLFGVFVQVISGNW----ELLYPAYFPF 163

  Fly   185 QWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIE---GLSICIYAEITFGIEVLCLELRQIHRHN 246
            ......           |....|:....:.:.:|   ||....|..:|     |||....:|..:
  Fly   164 DLESNR-----------FLGAVALGYQVFSMLVEGFQGLGNDTYTPLT-----LCLLAGHVHLWS 212

  Fly   247 YGLQELRMETNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNF-SLVS--LSVLEAVEARKDPKV 308
            ..:.:|....:..|..||::::.:::     |..|     |.| :|||  :|.::.|:.......
  Fly   213 IRMGQLGYFDDETVVNHQRLLDYIEQ-----HKLL-----VRFHNLVSRTISEVQLVQLGGCGAT 267

  Fly   309 VAQFAVLMLLALG-------HLSMWSYCGDQLSQKSLQISEAAYEA------------YDPTKGS 354
            :......||..:|       :|..:.....||.......||.|.|.            ||.   |
  Fly   268 LCIIVSYMLFFVGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQ---S 329

  Fly   355 KDVYRDLCVI--IRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFLLK 403
            :|...||.:.  :..|....|::|......||..:.|.|...|.:...:::
  Fly   330 RDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVVVR 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 65/349 (19%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 70/371 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.