DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or33b

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:353 Identity:75/353 - (21%)
Similarity:131/353 - (37%) Gaps:90/353 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TEERLLPYRSKWHTL---------------VYIQMVIFF-ASMSFGL--TESMGDHVQMGRDLAF 91
            :|:....|...||.|               :.|.:.|:: ..:..||  ..|:||   :.:.|..
  Fly    10 SEDIYRTYWLYWHLLGLESNFFLNRLLDLVITIFVTIWYPIHLILGLFMERSLGD---VCKGLPI 71

  Fly    92 ILGAFFIIFKTYYFCWYGDELDQV---ISDLDALHPWAQKGPNPVE----YQTGKR-----W-YF 143
            ....||..||...|.:...|:.::   ..:||      |:..:..|    .|..:|     | .|
  Fly    72 TAACFFASFKFICFRFKLSEIKEIEILFKELD------QRALSREECEFFNQNTRREANFIWKSF 130

  Fly   144 VMAFFLATSWSFFLCILLLLLITSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAV 208
            ::|:.|:.          :..|.|.::.....|.:.|.||:......|      |.:|..:|   
  Fly   131 IVAYGLSN----------ISAIASVLFGGGHKLLYPAWFPYDVQATEL------IFWLSVTY--- 176

  Fly   209 YCLTWLLCIEGLSICI--------YAEITFGI---EVLCLELRQIHRHNYGLQELRMETNRLV-- 260
                   .|.|:|:.|        |..:||.:   .|..|.:| :.|...|.:|....|.:.:  
  Fly   177 -------QIAGVSLAILQNLANDSYPPMTFCVVAGHVRLLAMR-LSRIGQGPEETIYLTGKQLIE 233

  Fly   261 ------KLHQKIVEILDRTNDVFHGTLIMQMGVNFSLVSLSVLEAVEARKDPKVVAQFAVLMLLA 319
                  || .||||:|..|.::......:..|||.|:..:::|...:   :...:..:.|..|..
  Fly   234 SIEDHRKL-MKIVELLRSTMNISQLGQFISSGVNISITLVNILFFAD---NNFAITYYGVYFLSM 294

  Fly   320 LGHLSMWSYCGDQLSQKSLQISEAAYEA 347
            :..|....|.|..:|.:..|::.|.|.:
  Fly   295 VLELFPCCYYGTLISVEMNQLTYAIYSS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 63/297 (21%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 66/302 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.