DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or30a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523520.2 Gene:Or30a / 34236 FlyBaseID:FBgn0032096 Length:377 Species:Drosophila melanogaster


Alignment Length:268 Identity:57/268 - (21%)
Similarity:111/268 - (41%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 CILLLLLITSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSI 222
            |...:..:|.|::..::.||:....|      ::....:|..| ::.:|.:..:     :..:..
  Fly   134 CCTCIGFVTYPIFGSERVLPYGMYLP------TIDEYKYASPY-YEIFFVIQAI-----MAPMGC 186

  Fly   223 CIYAEIT--------FGIEVLCLELRQIHRHNYGLQELRMETNR-----LVKLHQKI---VEILD 271
            |:|...|        |.| ::|..|:...|   .|::|:.|..|     .:|...|:   |:.::
  Fly   187 CMYIPYTNMVVTFTLFAI-LMCRVLQHKLR---SLEKLKNEQVRGEIIWCIKYQLKLSGFVDSMN 247

  Fly   272 RTNDVFHGTLIMQMGVNFSLVSLSVLEAVEARKDPKVVAQFAVL---MLLALGHLSMWSYCGDQL 333
            ..|...|....:..|....::..|::.|       :.:||..::   |::...:..:..|..::|
  Fly   248 ALNTHLHLVEFLCFGAMLCVLLFSLIIA-------QTIAQTVIVIAYMVMIFANSVVLYYVANEL 305

  Fly   334 SQKSLQISEAAYEA----YDPTKGSKDVYRDLCVIIRRGQDPL-IMRASPFPSFNLINYSAILNQ 393
            ..:|..|:.||||:    :|     .|..:.|..:|.|.|.|| |:....:| .||....::||.
  Fly   306 YFQSFDIAIAAYESNWMDFD-----VDTQKTLKFLIMRSQKPLAILVGGTYP-MNLKMLQSLLNA 364

  Fly   394 CYGILTFL 401
            .|...|.|
  Fly   365 IYSFFTLL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 54/260 (21%)
Or30aNP_523520.2 7tm_6 58..366 CDD:251636 54/260 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465298
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.