DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or22c

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:412 Identity:79/412 - (19%)
Similarity:162/412 - (39%) Gaps:93/412 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLPYRSK------WHTLVYIQMVIFFASMSFGLTESMGDHVQMGRDLAFILGAFFIIFKTYYFCW 107
            |.|.|.:      ||  .::..|..||.:                    ::||   :.:..|.|.
  Fly    26 LWPQRIRGGGGRPWH--AHLLFVFAFAMV--------------------VVGA---VGEVSYGCV 65

  Fly   108 YGDELDQVISDLDALHPWAQKGPNPVE----YQTGKRWYFVMAFFLATSW--------------- 153
            :   ||.::..|:|..|...|....::    :::.:||..::....|..|               
  Fly    66 H---LDNLVVALEAFCPGTTKAVCVLKLWVFFRSNRRWAELVQRLRAILWESRRQEAQRMLVGLA 127

  Fly   154 --SFFLCILLL--------------LLITSPMWV----HQQNLPFHAAFPFQWHEKSLHPISHAI 198
              :..|.:|||              |::....|:    .|..|||:...|....:..:.|::: :
  Fly   128 TTANRLSLLLLSSGTATNAAFTLQPLIMGLYRWIVQLPGQTELPFNIILPSFAVQPGVFPLTY-V 191

  Fly   199 IYLFQSYFAVYCLTWLLCIEGLSICIYAEITFGIEVLCLELRQIHRHNYG------LQELRMET- 256
            :........|:..::   ::|..||....|.....::..::|:|....:|      .:|:..|. 
  Fly   192 LLTASGACTVFAFSF---VDGFFICSCLYICGAFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVR 253

  Fly   257 NRLVKLHQKIVEILDRTNDVFHG-TLIMQMG-VNFSLVSLSVLEAVEARKDPKVVAQFAVLMLLA 319
            :||.::.::...|:|...|:... |:|:.|. ::.:.|..|.:..:...........:...::.|
  Fly   254 HRLAQVVERHNAIIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAA 318

  Fly   320 LGHLSMWSYCGDQLSQKSLQISEAAY--EAYDPTKGSKDVYRDLCVIIRRGQDPLIMRASPFPSF 382
            |..|.::.:.|:.:|:.|..:::..|  |.|.....::.|   :.:|:||.|....: |.||.:.
  Fly   319 LTQLFLYCFGGNHVSESSAAVADVLYDMEWYKCDARTRKV---ILMILRRSQRAKTI-AVPFFTP 379

  Fly   383 NLINYSAILNQCYGILTFLLKT 404
            :|....:||:.....:| ||||
  Fly   380 SLPALRSILSTAGSYIT-LLKT 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 66/361 (18%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 60/330 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435234
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.