DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or82a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:379 Identity:72/379 - (18%)
Similarity:152/379 - (40%) Gaps:53/379 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TLVYIQMVIFFASMSFGLTE----SMGDHVQMGRDLAFILGAFFIIFKTYYFCWYGDELDQVISD 118
            :|.:|..:||..|..:.|..    :..|..::...|:.:......:.|...|.....:..::|..
  Fly    30 SLKHISSLIFVISAQYPLISYVAYNRNDMEKVTACLSVVFTNMLTVIKISTFLANRKDFWEMIHR 94

  Fly   119 LDALHPWAQKGPNPVEYQTGKRWYF---VMAFFLATSWSFFLCILLLLLITSPM-------WVH- 172
            ...:|  .|...:...|:.|..:..   .:|.||..::.....:..|..:..|:       | | 
  Fly    95 FRKMH--EQSASHIPRYREGLDYVAEANKLASFLGRAYCVSCGLTGLYFMLGPIVKIGVCRW-HG 156

  Fly   173 ---QQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAEITFGIEV 234
               .:.||....|||    ..|....:.:.:|:.....|..:.:...::||.|.....:....:.
  Fly   157 TTCDKELPMPMKFPF----NDLESPGYEVCFLYTVLVTVVVVAYASAVDGLFISFAINLRAHFQT 217

  Fly   235 LCLELRQIHRHNYGLQE----LRMETNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNFSLVSLS 295
            |   .|||....:...|    :|:::  :|:.|..::.:..:...::..|::.|..:....|.:.
  Fly   218 L---QRQIENWEFPSSEPDTQIRLKS--IVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVI 277

  Fly   296 VLEAV---EARKDPKVVAQFAVLMLLALGHLSMWSYCGDQLSQKSLQISEAA-----YEAYDPTK 352
            :.:.|   ::..|..:.|.|...::|   .|.::.|.|:.:..:|||:..|.     :.|...|:
  Fly   278 IYQLVTNMDSVMDLLLYASFFGSIML---QLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTR 339

  Fly   353 GSKDVYRDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFLLKTLD 406
            .|      |.:||.:.|..:::||..|.: :|.|:..|......::| |:|:::
  Fly   340 TS------LSLIILQSQKEVLIRAGFFVA-SLANFVGICRTALSLIT-LIKSIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 62/337 (18%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 62/330 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.