DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or7a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_511081.1 Gene:Or7a / 31750 FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster


Alignment Length:294 Identity:52/294 - (17%)
Similarity:109/294 - (37%) Gaps:72/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 WYFVMAFFLATSWSFFLCILLLLLITSPMWVHQQNLPFHAAFP-FQWHEKSLHPISHAIIYLFQS 204
            |::.:.:.:.:| |.|:|..||   ..|        |:....| ..|....:.       :..|:
  Fly   146 WFYQICYAIYSS-STFVCAFLL---GQP--------PYALYLPGLDWQRSQMQ-------FCIQA 191

  Fly   205 YFAVYCLTWLLCIEGLSICIYAEI-----TFGIEVLCLELRQIHRHNYGLQELR----------M 254
            :.....:.| .|:...|..:||.|     ...:::|...:.::...:.|..|:.          .
  Fly   192 WIEFLIMNW-TCLHQASDDVYAVIYLYVVRIQVQLLARRVEKLGTDDSGQVEIYPDERRQEEHCA 255

  Fly   255 ETNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNFSLVSLSVLEA-VEARKDPKVVAQFAVLMLL 318
            |..|.:..||.::::||..:.|...|:.:|..:..:::..:::.. :.|..:.|:.   :::.||
  Fly   256 ELQRCIVDHQTMLQLLDCISPVISRTIFVQFLITAAIMGTTMINIFIFANTNTKIA---SIIYLL 317

  Fly   319 ALGHLSMWSYCGDQLSQKSLQISEAAYEA----YDPTK-----------GSKDVYRD-LCVIIRR 367
            |:                :||.:...|:|    .|..:           |....:|. |...:.|
  Fly   318 AV----------------TLQTAPCCYQATSLMLDNERLALAIFQCQWLGQSARFRKMLLYYLHR 366

  Fly   368 GQDPLIMRASPFPSFNLINYSAILNQCYGILTFL 401
            .|.|:.:.|......||..|.:|....:.:.|.:
  Fly   367 AQQPITLTAMKLFPINLATYFSIAKFSFSLYTLI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 51/286 (18%)
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 51/286 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.