DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or2a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:457 Identity:85/457 - (18%)
Similarity:160/457 - (35%) Gaps:150/457 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SHSSIYY-WREQMKAMALFTTTEERLLPYRSKWHTLVY---IQMVI------------FFASMSF 73
            :||::|| ||       ::..|.....|..|....:||   :.:|:            .|.:...
  Fly    11 THSAVYYHWR-------VWELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMA 68

  Fly    74 GLTESMGDHV-QMGRDLAFILGAFFIIFKTYYFCWYGDELDQVISDLDALHPWAQKGPNPVEYQT 137
            ||.|::...: .:..:|.|  ...:::.|         :|.::.|.|..:...|:...:|.|...
  Fly    69 GLCENLTITITDIVANLKF--ANVYMVRK---------QLHEIRSLLRLMDARARLVGDPEEISA 122

  Fly   138 ---------GKRWYFVMAFFLATSWSFFLCILLLLLITSPMWVHQQNLPFHAAFPFQWHEKSLHP 193
                     |....|...|...|:.|   |:   .::..|    .:.|.:.|.|...|    :|.
  Fly   123 LRKEVNIAQGTFRTFASIFVFGTTLS---CV---RVVVRP----DRELLYPAWFGVDW----MHS 173

  Fly   194 I-SHAIIYLFQSYFAVYCLTWLLCIEGLSICIYAEITFGIEVLC--------LELR------QIH 243
            . ::.:|.::|.:.        |.::.:..|  |..::....||        ||||      :..
  Fly   174 TRNYVLINIYQLFG--------LIVQAIQNC--ASDSYPPAFLCLLTGHMRALELRVRRIGCRTE 228

  Fly   244 RHNYG----------LQELRMETNRLVKLHQKIVEILDR-------------------------- 272
            :.|.|          .|||......|.::| ::.||:.|                          
  Fly   229 KSNKGQTYEAWREEVYQELIECIRDLARVH-RLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLY 292

  Fly   273 -TNDVFHGTLIMQMGVNFSLVSLSVLEAVEARKDPKVVAQFAVLMLLALGHLSMWSYCGDQLSQK 336
             .:|..|..:|:.: |.||.|:|.|               |.:            .|.||::..:
  Fly   293 VADDHDHTAMIISI-VFFSAVTLEV---------------FVI------------CYFGDRMRTQ 329

  Fly   337 SLQISEAAYEAYDPTKGSKDVYRDLCVIIRRGQDPLIMRASPFPSFNLINYSAILNQCYGILTFL 401
            |..:.:|.|:. :..:......|:|...:.|.|.|.::.|..:.:.:|..:..::...|.:.|.|
  Fly   330 SEALCDAFYDC-NWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLL 393

  Fly   402 LK 403
            |:
  Fly   394 LR 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 65/373 (17%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 68/385 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.