DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65b and Or46a

DIOPT Version :9

Sequence 1:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_995793.1 Gene:Or46a / 2768728 FlyBaseID:FBgn0026388 Length:384 Species:Drosophila melanogaster


Alignment Length:225 Identity:39/225 - (17%)
Similarity:92/225 - (40%) Gaps:41/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 YLFQSYFAVYCLTWLLCIEGLSICI----YAEITFG--------IEVLCLELRQI-----HRHNY 247
            |||.|          :|:  |..|:    |..:.:.        :::|.|.|.::     .:.| 
  Fly   173 YLFHS----------ICL--LPTCVLNITYDSVAYSLLCFLKVQLQMLVLRLEKLGPVIEPQDN- 224

  Fly   248 GLQELRMETNRLVKLHQKIVEILDRTNDVFHGTLIMQMGVNF-----SLVSLSVLEAVEARKDPK 307
              :::.||.......:.:||...|.......|...:|:..:.     :|..:|.:..  |..|..
  Fly   225 --EKIAMELRECAAYYNRIVRFKDLVELFIKGPGSVQLMCSVLVLVSNLYDMSTMSI--ANGDAI 285

  Fly   308 VVAQFAVLMLLALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPTKGSKDVYRDLCVIIRRGQDPL 372
            .:.:..:..|:.|..:.:..|..::::.:|.::..:.|.: ..|..::...|.:.::::|...|:
  Fly   286 FMLKTCIYQLVMLWQIFIICYASNEVTVQSSRLCHSIYSS-QWTGWNRANRRIVLLMMQRFNSPM 349

  Fly   373 IMRA-SPFPSFNLINYSAILNQCYGILTFL 401
            ::.. :|..:|:|..:.:|:|..|.....|
  Fly   350 LLSTFNPTFAFSLEAFGSIVNCSYSYFALL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 37/217 (17%)
Or46aNP_995793.1 7tm_6 62..373 CDD:251636 37/217 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.