DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or65a and Or49a

DIOPT Version :9

Sequence 1:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:383 Identity:70/383 - (18%)
Similarity:144/383 - (37%) Gaps:73/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RIVAWQYFVSIQLATALASLFYGISESIGDIVNLGRDLVFIIT--IIFICF-----RLVFFAQYA 119
            ||:.|:                .::.|...|:..|....::::  :.||.|     ||:..:.  
  Fly    59 RIIEWE----------------SLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSH-- 105

  Fly   120 GELDVIIDALEDIYHWSIKGPATKEVQE------TKRLHFLLFMALIITWFSFLILFMLIKISTP 178
                    .|:::|....:.....||.:      |:.:.::.:..:::     :.|..|::....
  Fly   106 --------RLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYFVMVV-----MALEPLVQSCIM 157

  Fly   179 FWIESQTLPFHVS--WPFQLHDPSKHPIAYIIIFVSQSTTMLYFLIWLGVVENMGVSLFFELTSA 241
            :.|......|...  :|.:|...|:.|:.|::.:|...|...:.     |..::|..|:....|:
  Fly   158 YLIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTYSQFI-----VNVSLGTDLWMMCVSS 217

  Fly   242 --------LRVLCIELRNLQELCLGDEDMLYRELCRMTKFHQQIILLTDRCNHIFNGAFIMQMLI 298
                    |..:...:|...|....|.|.    |..:.|.||.:|.|....|::| |..:...|.
  Fly   218 QISMHLGYLANMLASIRPSPETEQQDCDF----LASIIKRHQLMIRLQKDVNYVF-GLLLASNLF 277

  Fly   299 --NFLLVSLSLFEVLAAKKNPQVAVEYMIIMLMTLGHLSFWSKFGDMFSKESEQVALAVYEA--Y 359
              :.||..::.:.|:....  ...:.||::...........|..|.|....|..:|.|.:|:  |
  Fly   278 TTSCLLCCMAYYTVVEGFN--WEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWY 340

  Fly   360 DPNVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTILANTLE 417
            :   ||....::....:.:||:||.:.|......:|:.:..::...|....::..|:|
  Fly   341 E---GSLRYKKEILILMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIRQTVE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 53/280 (19%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 61/325 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.