DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG34409

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:259 Identity:64/259 - (24%)
Similarity:101/259 - (38%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYG-AGTIISNQWILT-----VKTVLKYSYIEVHLA 83
            |:.||.:|......:|..|.|....:|.:::. :|::||:..|:|     |..|.......|.|.
  Fly   249 RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLG 313

  Fly    84 SRRSYRGFDI--IRIYKENFRFHYDNDHVIALVKCPYQKFDRRMDRVRVPAYD--TRFERYVGNM 144
            |:.....|.|  :.::....:..|.||  |||::  ....:.....:.:|...  |...|.:|.:
  Fly   314 SQDGATPFAIEQVIVHPNYDQPKYAND--IALLR--INSTNGTFTPICLPFNGPITLGNRLIGQI 374

  Fly   145 TMVCGY---GTEKRHAKLPE----WMRCIEVEVMNNTECAKYYTPLKW----------YEMCTSG 192
            .:..|:   .||...:..|.    .:|.|.:.::|.|.||..|..|..          ..:|..|
  Fly   375 GVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQG 439

  Fly   193 EGFKGVCEGDIGGAVVTMGPNPTF--------IGIIWLMPENCSI-GYPSVHIRVSDHIKWIKR 247
            .....||.||.||..:..|.:..|        |||:...|..|.: ..|.|:..||....||.|
  Fly   440 MPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIPGVYTLVSSFSDWILR 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 61/255 (24%)
Tryp_SPc 26..248 CDD:304450 63/258 (24%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 61/255 (24%)
Tryp_SPc 252..501 CDD:238113 60/252 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.