DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and cela1.1

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:278 Identity:56/278 - (20%)
Similarity:107/278 - (38%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVTLLVLSLTVSVG-------EKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTII 61
            ::.:|:||:..::|       |...:..|:.||..||..:..:.:.:.| :|.....:|..||:|
Zfish     1 MLRILLLSVLAAIGLTEPRYLEDLAIEERVIGGEIAKPHSWPWQISLQY-QSGGRYHHYCGGTLI 64

  Fly    62 SNQWILTVKTVLKYSYI----------EVHLASRR--SYRGFDIIRIYKENFRFHYDNDHVIALV 114
            ...|::.....:..|.|          ..|....:  |.:|..|...:..|.   ..|.:.|||:
Zfish    65 RPGWVMVAAHCVDTSRIWSVALGDHDTTTHEGPEQYISVKGVFIHPNWNPNI---VANGNDIALL 126

  Fly   115 KCPYQ-KFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAK 178
            :.... .....:....:|:|.....  .|:...:.|:|..:....|...::...:.|:::..|::
Zfish   127 QLSINATLSSYVQVATLPSYGEILP--YGHTCYITGWGRTQTGGSLSAQLKQAYMPVVDHETCSQ 189

  Fly   179 ---YYTPLKWYEMCTSGEGFKGVCEGDIG--------GAVVTMGPNPTFIGIIWLMPENCSIGY- 231
               :.:.:|...:|..|......|.||.|        |..|..|.. :|:.     ...|:. | 
Zfish   190 SDWWGSTVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVHGVT-SFVA-----SSGCNT-YK 247

  Fly   232 -PSVHIRVSDHIKWIKRV 248
             |:|..|||.|:.|:..:
Zfish   248 KPTVFTRVSYHVSWLNHI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 50/245 (20%)
Tryp_SPc 26..248 CDD:304450 50/247 (20%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 50/244 (20%)
Tryp_SPc 30..265 CDD:238113 50/247 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.