DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and C1s1

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:263 Identity:73/263 - (27%)
Similarity:113/263 - (42%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVL-KYS--YIE 79
            |..::..||.||..||.....:.   |:|....:|     |.:|:..|:||...|| |.|  .:.
Mouse   436 EPFQVHQRIFGGQPAKIENFPWQ---VFFNHPRAS-----GALINEYWVLTAAHVLEKISDPLMY 492

  Fly    80 VHLASRRSYRGFDIIRIYKE--------------NFRFHYDNDHVIALVKCPYQKFDRRMDRVRV 130
            |...|.|:....:..|:|.:              |.|.::|||..:..:|.|. |...::..:.:
Mouse   493 VGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPV-KMGPKVSPICL 556

  Fly   131 PAYDTRFERYVGNMTMVCGYG-TEK-------RHAKLP--EWMRCIEVEVMNNTECAKYYTPLKW 185
            |...:.:....|:|.::.|:| |||       |.||:|  ....|.:|:..|.|...:.|.... 
Mouse   557 PGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTD- 620

  Fly   186 YEMCTSGEGFKGV--CEGDIGGAVVTMGPN---PTF--IGII-WLMPENCSIGYPSVHIRVSDHI 242
             .|..:||  |||  |.||.|||.....||   |.|  .|:: |  .:.|  |...|:.:|.:::
Mouse   621 -NMICAGE--KGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSW--GKRC--GTYGVYTKVKNYV 678

  Fly   243 KWI 245
            .||
Mouse   679 DWI 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 70/254 (28%)
Tryp_SPc 26..248 CDD:304450 71/255 (28%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056
Tryp_SPc 443..681 CDD:214473 70/254 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.