DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and ctrb2

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:270 Identity:60/270 - (22%)
Similarity:112/270 - (41%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVLSLTVSVGE---------KNKLS--PRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTI 60
            |.:||..|.:|.         |..:|  .||..|..|.:.:..:.|.:    ...:..::..|::
 Frog     4 LFLLSCIVLIGSTYGCGVPAIKPIISGYARIVNGENAVSGSWPWQVSL----QDRTGFHFCGGSL 64

  Fly    61 ISNQWILTV---------KTVL-KYSYIEVHLASRRSYRGFDIIRIYKE-NFRFHYDNDHVIALV 114
            ::|.|::|.         :.:| :|.    ..:|....:...|.|::|. |:..:...:.:..|.
 Frog    65 VNNLWVVTAAHCGVTTSHRVILGEYD----RSSSAEPIQTMSISRVFKHPNYNTNTMINDITLLK 125

  Fly   115 KCPYQKFDRRMDRVRVPAYDTRF---ERYVGNMTMVCGYGTEKRHAKL-PEWMRCIEVEVMNNTE 175
            ......|:.|:..|.:|.....|   ||.:     ..|:|....::|| |..::.:.:.:::|||
 Frog   126 LSSTASFNSRVAPVCIPTSSEVFNSPERCI-----TTGWGYVDAYSKLSPNKLQQVTLPLLSNTE 185

  Fly   176 CAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFI--GIIWLMPENCSIGYPSVHIRV 238
            |.:|:.......|..:|......|.||.||.:| ...|..::  ||:......||...|.|:.||
 Frog   186 CQRYWGNKIHSTMICAGASGASSCMGDSGGPLV-CARNGAWVLAGIVSWGSSTCSPSSPGVYARV 249

  Fly   239 SDHIKWIKRV 248
            |....|:.::
 Frog   250 STLRSWMDQI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 52/236 (22%)
Tryp_SPc 26..248 CDD:304450 52/238 (22%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 52/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.