DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG11842

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:264 Identity:61/264 - (23%)
Similarity:98/264 - (37%) Gaps:58/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SPRIAGGYRA--KTFTIIYLVGIVYFKSQTSSLN-YGAGTIISNQWILTVKTVLKYSYIEVHLAS 84
            :|.|.||..|  |.|.....:|   .|.:...:. :..||:||::.:||...........|::| 
  Fly    70 APLIIGGGPAVPKEFPHAARLG---HKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIA- 130

  Fly    85 RRSYRGFDI-----------IRIYKENFRFHYD---NDHVIALVKCPYQKFDRRMDRVRVPAYDT 135
            |.....||.           ::.:..:..|.|.   ||..:..:..|. .|:.......:|..|.
  Fly   131 RLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPV-TFNDYKHPACLPFDDG 194

  Fly   136 RFERYVGNMTMVCGYG-------TEKR---HAKLPEW-MRCIEVEVMNNTECAKYYTPLKWYEMC 189
            |    :|...:..|:|       ||.:   ..||..: .|| .:....|.|..:.|....  ::|
  Fly   195 R----LGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRC-RITADRNDELPEGYNATT--QLC 252

  Fly   190 TSGEGFKGVCEGDIGGAVV-----------TMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIK 243
            ......|..|.||.||.|:           .||  .|.||:....|:     .|:::.||..::.
  Fly   253 IGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMG--ITSIGVACDTPD-----LPAMYTRVHFYLD 310

  Fly   244 WIKR 247
            |||:
  Fly   311 WIKQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 57/258 (22%)
Tryp_SPc 26..248 CDD:304450 60/261 (23%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 60/261 (23%)
Tryp_SPc 73..312 CDD:214473 57/257 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.