DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG4815

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:290 Identity:59/290 - (20%)
Similarity:108/290 - (37%) Gaps:70/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVTLLVL-SLTVSVGEK----NKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIIS 62
            ||..||:| |:....|.:    .:..|||..|.:. |...:..|||..|..:         .::.
  Fly     7 LVRLLLILNSVRTEAGNREEWTGRFHPRIYNGIKT-TVESLGGVGIQLFNGR---------KLVC 61

  Fly    63 NQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDNDHVIALVKCP-YQKFDRRMD 126
            :..:||.:.:|    ...|.....:...|.:|......|.:|.:|.:...|::.. :.|:.:...
  Fly    62 SATLLTPRHIL----TAAHCFENLNRSKFHVIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMKF 122

  Fly   127 RVRVPAYDTRF---ERYVG------------NMTMVCGYG------TEKRHAKLPEWMRCIEVEV 170
            ...|....|::   .:|:|            :..:..|:|      .|.|    .:..|.::|.:
  Fly   123 IADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDESR----KKTFRSMKVGI 183

  Fly   171 MNNTECAKYY-TPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIG---- 230
            ::..:|.|.. ..:....:|......|.:|.||.||        |..:|     .:.|.|.    
  Fly   184 VSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGDSGG--------PLLLG-----RQVCGINTWTF 235

  Fly   231 ------YPSVHIRVSDHIKWIKR-VSGVGF 253
                  .|.|::.|..:.|:||| ::.:||
  Fly   236 KCGNNEKPDVYMGVRYYAKFIKRTINRMGF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 46/252 (18%)
Tryp_SPc 26..248 CDD:304450 48/255 (19%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 44/239 (18%)
Trypsin 49..256 CDD:278516 42/236 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.