DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG10232

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:293 Identity:63/293 - (21%)
Similarity:113/293 - (38%) Gaps:90/293 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTVSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSL-NYGAGTIISNQWILT-VKTVLK 74
            |..|.|:...|. |:|.|..|:.....::..::|...:.|:: |..:|::|:.:::|| ...|:|
  Fly   244 LPTSCGQAPPLY-RMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVK 307

  Fly    75 YSYIEVHLASRRSYRG-FDI----------------IRIYKENFRFH--------YDNDHVIALV 114
            ...:...|..||...| .||                :.|..|.|..|        :::|  ||||
  Fly   308 DKMVNTDLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESD--IALV 370

  Fly   115 KCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVC------------------GYGTEKRHAKLPE 161
                        |::.|.      ||...:..:|                  ||...:.::::  
  Fly   371 ------------RLQTPV------RYTHEILPICVPKDPIPLHNHPLQIAGWGYTKNREYSQV-- 415

  Fly   162 WMRCIEVEVMNNTECA-KYY--TPLKWY----EMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGI 219
                    :::||... :||  ..:.::    ::|.||...:..||||.||.:: :..|..:..|
  Fly   416 --------LLHNTVYENRYYCQDKISFFRNESQICASGIRGEDSCEGDSGGPLM-LTLNNDYQDI 471

  Fly   220 IWLM------PENCSIGYPSVHIRVSDHIKWIK 246
            ::|.      .|||....|.|:.:......|||
  Fly   472 VYLAGIVSYGSENCGDRKPGVYTKTGAFFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 56/277 (20%)
Tryp_SPc 26..248 CDD:304450 58/279 (21%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 57/276 (21%)
Tryp_SPc 260..503 CDD:214473 54/273 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.