DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and SPE

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:280 Identity:67/280 - (23%)
Similarity:105/280 - (37%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIAGGYRAKTFTIIYLVGIVYFK--SQTSSLNYGAGTIISNQWILTVKTVL-------------- 73
            ||.||.....:...::|.:.|.|  |:|.:.|.| |.:::::::||....|              
  Fly   134 RIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCG-GALLNSRYVLTAGHCLASRELDKSGAVLHS 197

  Fly    74 --------------------------KYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDNDHVIA 112
                                      |:..|||.       :|. |..:|..|   ..|..:.||
  Fly   198 VRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVE-------KGI-IHEMYAPN---SVDQRNDIA 251

  Fly   113 LVKCPYQKFDRRMDRVR---VPAYDTRFERYVGNMTMVCGYG-TEKRHAKLPEWMRC-IEVEVMN 172
            ||:  .::.....|.||   :|........:|.....|.|:| ||...   |..::. |.|.|.|
  Fly   252 LVR--LKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQ---PSAIKLKITVNVWN 311

  Fly   173 NTECAKYYTPLKW----YEMCTSGEGFKGVCEGDIGGAV---VTMGPNPTF--IGIIWLMPENCS 228
            .|.|.:.|:..|.    .:||..|:.....|.||.||.:   ::.|....|  .|:.....:.|.
  Fly   312 LTSCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCG 376

  Fly   229 I-GYPSVHIRVSDHIKWIKR 247
            : |:|.|:.|....|.|||:
  Fly   377 LKGWPGVYTRTGAFIDWIKQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 64/276 (23%)
Tryp_SPc 26..248 CDD:304450 66/279 (24%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 66/279 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436392
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.