DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG17475

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:233 Identity:53/233 - (22%)
Similarity:84/233 - (36%) Gaps:67/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YG----AGTIISNQWILTVKTVLKYSYIEVHL---ASRRSYRGFDIIRIYKENFRFHYDNDHVIA 112
            ||    .|.||..:.:||....: |.|...:|   .....|...|.:...:|::           
  Fly    71 YGGHICGGCIIDERHVLTAAHCV-YGYNPTYLRVITGTVEYEKPDAVYFVEEHW----------- 123

  Fly   113 LVKCPYQKFDRRMDRVRVPAYDT-RFERYV------------GNMTMVCGYGTEKRHAKLPE--- 161
             :.|.|...|...|...:...|| :|..|.            |...::.|:|:.:.....|:   
  Fly   124 -IHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQ 187

  Fly   162 --------WMRCIEVEVMNNT----ECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNP 214
                    :..|  .|:|||.    .|          .:||...|.:|.|.||.||.:.   .|.
  Fly   188 KAYLTHVVYSTC--QEIMNNDPSNGPC----------HICTLTTGGQGACHGDSGGPLT---HNG 237

  Fly   215 TFIGII-WLMPENCSIGYPSVHIRVSDHIKWIK-RVSG 250
            ...|:: |..|  |::|.|..|..|..:::||: .:||
  Fly   238 VLYGLVNWGYP--CALGVPDSHANVYYYLEWIRSMISG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 49/225 (22%)
Tryp_SPc 26..248 CDD:304450 51/229 (22%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 49/225 (22%)
Tryp_SPc 50..269 CDD:238113 51/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.