DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG17477

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:253 Identity:62/253 - (24%)
Similarity:104/253 - (41%) Gaps:50/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IAGGYRAKTFTIIYLVGIVYFKSQT---SSLNYGAGTIISNQWILTVKTVLK-YSYIEVHLASRR 86
            |.||..|......|.|.:     ||   |.|..||  |||::||:|....:| |....:.:|:  
  Fly    27 IVGGQNAAEGDAPYQVSL-----QTLLGSHLCGGA--IISDRWIITAGHCVKGYPTSRLQVAT-- 82

  Fly    87 SYRGFDIIR-------IYKENFRFH-------YDNDHVIALVKCPYQ-KFDRRMDRVRVPAYDTR 136
                 ..||       .|.:....|       |.||  |.|:..... .|:.....|.:|.  :.
  Fly    83 -----GTIRYAEPGAVYYPDAIYLHCNYDSPKYQND--IGLLHLNESITFNALTQAVELPT--SP 138

  Fly   137 FERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTPLKWYEM-----CTSGEGFK 196
            |.|....:... |:|::.....||..::.::.:.:|:..|....:..:..|:     |...:...
  Fly   139 FPRGASELVFT-GWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANI 202

  Fly   197 GVCEGDIGGAVVTMGPNPTFIGII-WLMPENCSIGYPSVHIRVSDHIKWIKR-VSGVG 252
            |.|.||.||.:|..|   |.:||: :.:|  |:.|.|.:.:.:..:..|::: :||.|
  Fly   203 GACHGDSGGPLVHQG---TLVGILNFFVP--CAQGVPDIFMNIMYYRDWMRQTMSGNG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 58/243 (24%)
Tryp_SPc 26..248 CDD:304450 59/247 (24%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 59/246 (24%)
Tryp_SPc 27..246 CDD:214473 58/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.