DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG9649

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:257 Identity:50/257 - (19%)
Similarity:91/257 - (35%) Gaps:80/257 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IAGGYRAKTFTIIYLVGIVYFKSQT-------SSLNYGAGTIISNQWILTVKTVL---KYS---Y 77
            :.||......|:|.......|.|:.       .||...:..:.|:...|.|..:|   :|:   |
  Fly   285 LCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVY 349

  Fly    78 IEVHLASRRSYRGFDI------IRIYKENFRFHYDNDHVIALVKCPYQKFDRRMDRVRVPAYDTR 136
            .:..||..:.....||      |.::.|||           |::.|                   
  Fly   350 TDADLALLQLSNHVDIGDYIKPICLWNENF-----------LLELP------------------- 384

  Fly   137 FERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTEC--------AKYYTPLKWYEMCTSGE 193
                .|:.:.|.|:|.:::..:.....:..:.:::...||        ||:.|.   :.:|.|..
  Fly   385 ----SGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITS---HTICASNA 442

  Fly   194 GFKGVCEGDIGGAVVTMGPNPTFIGIIWL----------MPENCSIGYPSVHIRVSDHIKWI 245
            ...|.|.||.||.::....:      ||:          |...|::..|.::..|:.||:|:
  Fly   443 QASGPCSGDSGGGLMLQEQD------IWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 49/255 (19%)
Tryp_SPc 26..248 CDD:304450 50/257 (19%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 49/255 (19%)
Tryp_SPc 259..497 CDD:214473 49/254 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.