DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and Jon74E

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001189126.2 Gene:Jon74E / 39959 FlyBaseID:FBgn0023197 Length:271 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:115/277 - (41%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVTLLVLSLTVSVGEK-------NKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTII 61
            :.|:||..|.:..|..       :.:..|||||..|:.....|.||:...:........|| ::|
  Fly     3 ISTILVFLLILVQGRSISCLDMGHGIGGRIAGGELARANQFPYQVGLSIEEPNDMYCWCGA-SLI 66

  Fly    62 SNQWILTV-----KTVLKYSYI--EVHLASRRSYRGFDIIRIYKENFRFHYD-------NDHVIA 112
            |::::||.     |.|....|:  .:.||.|:      :||........|.|       ||  ||
  Fly    67 SDRYLLTAAHCVEKAVAITYYLGGVLRLAPRQ------LIRSTNPEVHLHPDWNCQSLEND--IA 123

  Fly   113 LVKCPYQKFDRRMDR-VRVPAYDTRFERYVGNMTMVCGYG-TEKRHAKLPEWMRCIEVEVMNNTE 175
            ||:.|.........| :|:|...:....|.....:..|:| .......:.:.:|.:...|.:|.:
  Fly   124 LVRLPEDALLCDSIRPIRLPGLSSSRNSYDYVPAIASGWGRMNDESTAISDNLRYVYRFVESNED 188

  Fly   176 CAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGP---NPTFIGII-WLMPENCSIGYPSVHI 236
            |...|..:|...:|....|.|..|.||.||.:|...|   ....||:. :.....|:.|||||..
  Fly   189 CEYSYANIKPTNICMDTTGGKSTCTGDSGGPLVYSDPVQNADILIGVTSYGKKSGCTKGYPSVFT 253

  Fly   237 RVSDHIKWIKRVSGVGF 253
            |::.::.||..||||.:
  Fly   254 RITAYLDWIGEVSGVHY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 63/239 (26%)
Tryp_SPc 26..248 CDD:304450 64/241 (27%)
Jon74ENP_001189126.2 Tryp_SPc 31..262 CDD:214473 63/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.